BETA-ENDORPHIN, HUMAN

BETA-ENDORPHIN, HUMAN Suppliers list
Company Name: SynPep Corporation  
Tel:(925) 803-9250 (International)
Email:sales@synpep.com
Products Intro:
Company Name: Research Plus, Inc.  
Tel:800 341-2296 (U.S. and Canada)
Email:respls@aol.com
Products Intro:
Company Name: NeoMPS SA  
Tel:(33) 3 88 79 08 79
Email:neo@neomps.com
Products Intro:
Company Name: Peptide Institute, Inc.  
Tel:+81 (0) 72 729 4121
Email:info@peptide.co.jp
Products Intro:
Company Name: The Peptide Laboratory  
Tel:707 745 1500
Email:info@peptidelab.com
Products Intro:
BETA-ENDORPHIN, HUMAN Basic information
Product Name:BETA-ENDORPHIN, HUMAN
Synonyms:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-TYR-LYS-LYS-GLY-GLU;BETA-ENDORPHIN (1-27) (HUMAN);BETA-ENDORPHIN;BETA-ENDORPHIN FRAGMENT 1-27 HUMAN;BETA-ENDORPHIN, HUMAN;BETA-LIPOTROPIN (61-91), HUMAN;BETA-LIPOTROPIN C-FRAGMENT, HUMAN
CAS:
MF:C158H251N39O46S
MW:3464.98
EINECS:262-330-3
Product Categories:
Mol File:Mol File
BETA-ENDORPHIN, HUMAN Structure
BETA-ENDORPHIN, HUMAN Chemical Properties
storage temp. −20°C
Safety Information
Safety Statements 22-24/25
WGK Germany 3
10
MSDS Information
ProviderLanguage
SigmaAldrich English
BETA-ENDORPHIN, HUMAN Usage And Synthesis
BETA-ENDORPHIN, HUMAN Preparation Products And Raw materials
Tag:BETA-ENDORPHIN, HUMAN Related Product Information
GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU LYS-LYS-GLY-GLU