ChemicalBook > Product Catalog >Biochemical Engineering >Polypeptide >Exendin-4

Exendin-4

Exendin-4 Suppliers list
Company Name: Henan Tianfu Chemical Co.,Ltd.
Tel: 0371-55170693
Email: info@tianfuchem.com
Products Intro: CAS:141758-74-9
Purity:99% Package:500G;1KG;5KG;25KG
Company Name: Cellmano Biotech Limited  Gold
Tel:+86-551-65326643
Email:info@cellmano.com
Products Intro:Product Name:Exenatide
CAS:141758-74-9
Purity:98% HPLC Package:5Mg;10Mg;1g
Company Name: Nanjing Sunlida Biological Technology Co., Ltd.  Gold
Tel:025-58378339;025-57798810
Email:sales@sunlidabio.com
Products Intro:Product Name:Exendin-4
CAS:141758-74-9
Remarks:SLD-0809
Company Name: MedChemexpress LLC  Gold
Tel:609-228-6898
Email:sales@medchemexpress.com
Products Intro:Product Name:Exendin-4
Purity:>98% Package:900RMB/1mg
Company Name: 3B Pharmachem (Wuhan) International Co.,Ltd.  
Tel:86-21-50328103 * 801、802、803、804 Mobile:18930552037
Email:3bsc@sina.com
Products Intro:Product Name:Exendin-4
CAS:141758-74-9
Purity:99% HPLC Package:1Mg ; 5Mg;10Mg ;100Mg;250Mg ;500Mg ;1g;2.5g ;5g ;10g
Exendin-4 Basic information
New diabetes drugs Uses
Product Name:Exendin-4
Synonyms:H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-4;M.W. 4186.61 C184H282N50O60S;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide
CAS:141758-74-9
MF:C184H282N50O60S1
MW:4186.57
EINECS:
Product Categories:Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors
Mol File:Mol File
Exendin-4 Structure
Exendin-4 Chemical Properties
RTECS VT9545000
storage temp. −20°C
Safety Information
WGK Germany 3
MSDS Information
ProviderLanguage
SigmaAldrich English
Exendin-4 Usage And Synthesis
New diabetes drugsDiabetes is a metabolic disorder characterized by chronic hyperglycemia caused by a variety of causes , high blood sugar is caused by insulin secretion or its effect defect. Diabetes can be divided into type 1 diabetes, type 2 diabetes, other specific types of diabetes, and gestational diabetes, among which type 2 diabetes account for more than 90%.
Exendin-4 is a new diabetes drug successfully developed by American Eli Lilly Company it belongs to incretin analogues, it is the first member of the incretin analogues family , it is the synthetic peptide compound, which can simulate physiological behavior of the natural state secretion of GLP-1 in vivo ,it is similar to human pancreatic glucagon-like peptide effect-1 (GLP-1),it can promote glucose-dependent insulin secretion, it has inhibition effect of inappropriate glucose-dependent glucagon secretion, slowing gastric emptying, it improves the sensitivity of peripheral tissues to insulin, and it makes blood sugar adequately controlled. Clinically it is used for the treatment of type Ⅱ diabetes patients whose blood sugar is unbale to be controlled by metformin, sulfonylurea, or combination of metformin and sulfonylurea.
From April 28, 2005 to October 29, 2008, the US Food and Drug Administration (abbreviation: FDA) Adverse Event Reporting System had received reports of 78 cases of patients with renal exenatide change. In the meantime, the United States had made a total of more than 6.6 million Exendin-4 prescription, therefore, FDA thought the received 78 cases was in a small proportion of the proportion of all patients reporting use of the drug. Currently FDA has completed an assessment of these reported cases, including 62 cases of acute renal failure cases and 16 cases of renal insufficiency cases. Acute renal failure or renal dysfunction occurs three days to two years after treatment. The age span is 23 years to 83 years, mean age is 60 years.
The above information is edited by the chemicalbook of Tian Ye.
UsesExendin-4 can activate the GLP-1 receptor, the receptor can increase cAMP levels of pancreatic acinar cells in intracellular , but it has no effect on VIP receptor.
DefinitionChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.
Exendin-4 Preparation Products And Raw materials
Tag:Exendin-4(141758-74-9) Related Product Information
BIOTIN-EXENDIN 4 EXENDIN (5-39) EXENDIN 4 (48-83) [HELODERMA SUSPECTUM] EXENDIN (9-39), [125I]- EXENDIN-3 (9-39) AMIDE,EXENDIN 3 (9-39),EXENDIN [9-39] PEPTIDE,EXENDIN (9-39),EXENDIN (9-39) AMIDE,EXENDIN FRAGMENT 9-39 EXENDIN-4 (3-39),EXENDIN (3-39) exendin receptor fluorescein-Trp(25)-exendin-4 EXENDIN-3 EXENDIN-4,RECOMBINANT EXENDIN 4, FAM-LABELED Recombinant Exendin-4 (DES-HIS1, GLU8)-EXENDIN-4 Exendin-4 EXENATIDE ACETATE(EXENDIN-4)