ChemicalBook Chinese Germany Japanese Korean

BOC Sciences Company Information

Company Name:    BOC Sciences
Tel:    -
Email:    inquiry@bocsci.com
Nationality:    United States
WebSite:    https://www.bocsci.com/
Product List:    19743
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Product List
Receptor tyrosine-protein kinase erbB-2 precursor (369-386)
Receptor tyrosine-protein kinase erbB-2 (689-697)
Rho-related GTP-binding protein RhoC (176-185)
Ribosomal protein S26 (47-61)
Retinal dehydrogenase 1 (88-96)
Receptor tyrosine-protein kinase erbB-2 (952-961)
Rho guanine nucleotide exchange factor 17 (425-438)
RER1 protein (80-91)
Telomerase reverse transcriptase (461-469)
Regulator of G-protein signaling 5 (5-13)
Receptor tyrosine-protein kinase erbB-2 (754-762)
Rhodopsin Epitope Tag
Regulator of G-protein signaling 5 (74-83)
TAG-1 A2 (78-86)
Talin (777-785)
Telomerase reverse transcriptase (672-686)
TAG-2 (42-50)
Telomerase reverse transcriptase (865-873)
SYSMEHFRWGKPS
Serine/threonine-protein kinase B-raf (586-614)
Telomerase reverse transcriptase (540-548)
Serine protease hepsin (191-199)
TDSP5
Survivin (80-88)
Telomerase Reverse Transcriptase (674-683)
Small nuclear ribonucleoprotein Sm D1 (11-19)
Telomerare Reverse Transcriptase (hTRT) (653-661)
TAMRA-β-Amyloid (1-42), human 1802087-80-4
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT))
Telomerase reverse transcriptase (766-780)
Protein SSX2 (101-111)
Protein SSX2 (41-49)
Sarcoma antigen 1 (715-723)
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid 458528-68-2
Serine protease hepsin (229-237)
Small subunit processome component 20 homolog (626-634)
Survivin (18-27)
Sodium-coupled monocarboxylate transporter 2 (343-356)
Protein SSX2 (45-58)
Secernin-1 (196-204)
SSA protein SS-56 (55-64)
Prostatic acid phosphatase (112-120)
Protein SSX2 (19-34)
Serine/threonine-protein kinase mTOR (89-98)
Prostatic acid phosphatase (18-26)
Protein SSX4 (151-170)
Sperm surface protein Sp17 (103-111)
STh 118447-40-8
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid 458528-71-7
St-Ht31 P 252869-81-1
Structure-specific endonuclease subunit SLX4 (603-615)
Protein enabled homolog (443-451)
Protein SSX2 (37-54)
Ribosome-binding protein 1 (879-887)
Survivin-3A (96-104)
Serine protease hepsin (268-276)
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Siyry 178561-37-0
Secretin (5-27) (Porcine) 19665-15-7
RPL8 protein (31-41)
Protein SSX2 (45-59)
Surface IgG (sA20-Ig) of A20 (106-114)
Receptor-type tyrosine-protein phosphatase kappa (667-682)
Receptor tyrosine-protein kinase erbB-2 (63-71)
Receptor tyrosine-protein kinase erbB-2 (391-399)
Receptor-type tyrosine-protein kinase FLT3 (591-600)
Putative protein product of HMFN1045 (253-264)
Protein SSX4 (61-80)
PSMA/PSM-P1 (4-12)
Receptor tyrosine-protein kinase erbB-2 (650-658)
Protein SSX4 (31-50)
PSCA (14-22)
Receptor tyrosine-protein kinase erbB-2 (665-673)
Receptor tyrosine-protein kinase erbB-2 (369-377)
Receptor tyrosine-protein kinase erbB-2 (1023-1032)
Ras-related protein Rab-27A (178-186)
Protein phosphatase 1 regulatory subunit 3B (172-180)
Receptor tyrosine-protein kinase erbB-2 (466-474)
[pThr3]-CDK5 Substrate 1670273-47-8
Protein OS-9 (438-446)
Protein enabled homolog (502-510)
Protein SSX4 (41-60)
PSM P2 (711-719)
PSMA-PEG4 2256069-92-6
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid 1932808-80-4
Protein timeless homolog (848-856)
Ras-related protein Rab-38 (50-58)
Receptor tyrosine-protein kinase erbB-2 (48-56)
Receptor tyrosine-protein kinase erbB-2 (5-13)
Proto-oncogene PIM1 (191-199)
Rabenosyn-5 (541-552)
Prostatic acid phosphatase (299-307)
Receptor tyrosine-protein kinase erbB-2 (402-410)
Protein SSX4 (51-70)
PSMA (27-38)
Receptor tyrosine-protein kinase erbB-2 (435-443)
Protein SSX4 (161-180)
Receptor tyrosine-protein kinase erbB-2 (654-662)
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153 141171-54-2
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid 374119-33-2
170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198

Copyright 2007©  ChemicalBook. All rights reserved.