ChemicalBook Chinese

Company Information
Company Name:    Peptide Institute, Inc.
Tel:    +81 (0) 72 729 4121
Fax:    +81 (0) 72 729 4124
Email:    info@peptide.co.jp
Nationality:    Japan
WebSite:    www.peptide.co.jp
Product List:    992
1 2 3 4 5 6 7 8 9 10

Product List
ANTI-HUMAN MIDKINE
HATU 148893-10-1
ALA-ASP-CYS-LYS-TYR-LYS-PHE-GLU-ASN-TRP-GLY-ALA-CYS-ASP-GLY-GLY-THR-GLY-THR-LYS-VAL-ARG-GLN-GLY-THR-LEU-LYS-LYS-ALA-ARG-TYR-ASN-ALA-GLN-CYS-GLN-GLU-THR-ILE-ARG-VAL-THR-LYS-PRO-CYS-THR-PRO-LYS-THR-LYS-ALA-LYS-ALA-LYS-ALA-LYS-LYS-GLY-LYS-GLY-LYS-ASP
CNP-53 (PORCINE, RAT)
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 357952-10-4
D-A2PR(NMA)-GLY-[PHE/ALA/VAL/GLU/ARG]-[PRO/TYR/LYS/ILE/ASP]-PRO-ALA-PHE-PRO-LYS(DNP)-D-ARG-D-ARG TRIFLUOROACETATE
SUC-D-ASP-MCA
BOC-LEU-ARG-ARG-7-AMINO-4-METHYLCOUMARIN
SUC-ALA-PNA
AC-YVAD-CMK 178603-78-6
SAR-ARG-VAL-TYR-ILE-HIS-PRO-ALA 38027-95-1
ANTI-GROWTH HORMONE RELEASING FACTOR, RAT
IMPERATOXIN A 172451-37-5
ARG-PRO-LYS-PRO-GLN-GLN-PHE-PHE-GLY-LEU-MET-NH2 3ACOH 5H2O 11035-08-8
H-CYS-THR-CYS-PHE-THR-TYR-LYS-ASP-LYS-GLU-CYS-VAL-TYR-TYR-CYS-HIS-LEU-ASP-ILE-ILE-TRP-OH 125692-40-2
DES-ARG10-KALLIDIN 2ACOH 4H2O
ASP-MET-HIS-ASP-PHE-PHE-VAL-GLY-LEU-MET-NH2 1/2ACOH 4H2O
SNX-482
SAR-ARG-VAL-TYR-VAL-HIS-PRO-ALA ACOH 4H2O
BOC-D-Alanine 7764-95-6
BOC-D-GLN-ONP 74086-23-0
MG-115 133407-86-0
TYR-D-ALA-GLY-PHE-MET ACOH H2O 100929-62-2
ANTI-CORTICOTROPIN RELEASING FACTOR, HUMAN
(2R,5S)-5-AMINO-8-GUANIDINO-4-OXO-2-P-HYDROXYPHENYLMETHYLOCTANOIC ACID HEMISULFATE MONOHYDRATE 144110-38-3
CART (55-102) (RAT) 209615-79-2
(TYR34)-PTH (7-34) AMIDE (BOVINE) 86292-93-5
FMOC-HIS(TRT)-CLEAR-ACID RESIN
AMYLOID BETA-PROTEIN (42-1) TRIFLUOROACETATE 317366-82-8
DAPT
Secretin 17034-35-4
PLEIOTROPHIN, HUMAN
N-CHLOROACETYL-N-HYDROXY-L-LEUCYL-L-ALANYL-GLYCINE AMIDE
ARG-PRO-PRO-GLY-PHE-SER-PRO-TYR-ARG 32222-00-7
FMOC-GLN(TRT)-CLEAR-ACID RESIN
POLY-L-GLUTAMIC ACID SODIUM SALT 26247-79-0
Fmoc-D-Trp(Boc)-OH 163619-04-3
(7-METHOXYCOUMARIN-4-YL)ACETYLGLYCYL-L-SERYL-L-PROLYL-L-ALANYL-L-PHENYLALANYL-L-LEUCYL-L-ALANYL-[N-EPSILON-(2,4-DINITROPHENYL)-L-LYSYL]-D-ARGININE AMIDE
Ethyl N-benzoyl-L-argininate hydrochloride 2645-08-1
Z-EK(BIO)D-AOMK
BRADYKININ-POTENTIATOR C 3H2O
Z-GLY-LEU-NH2 7535-72-0
Fmoc-D-Aspartic acid beta-tert-butyl ester 112883-39-3
ARG-PRO-HYP-GLY-PHE-SER-PRO-PHE-ARG 37642-65-2
ANTI-GALANIN (PORCINE)
ANTI-GAP (28-56) (RAT)
ALPHA-CGRP (RAT) 83651-90-5
FMOC-TRP(BOC)-CLEAR-ACID RESIN
SARALASIN 34273-10-4
ANTI HUMAN RXR-ALPHA
PHOSPHORAMIDON 36357-77-4
BOC-ASP-OH 4587-33-1
CGP 42112 127060-75-7
ANGIOTENSIN II, HUMAN 4474-91-3
BOC-ILE-GLU-GLY-ARG-AMC ACETATE SALT 65147-06-0
Boc-S-(4-methylbenzyl)-L-cysteine 61925-77-7
ALA-GLN-GLU-PRO-VAL-LYS-GLY-PRO-VAL-SER-THR-LYS-PRO-GLY-SER-CYS-PRO-ILE-ILE-LEU-ILE-ARG-CYS-ALA-MET-LEU-ASN-PRO-PRO-ASN-ARG-CYS-LEU-LYS-ASP-THR-ASP-CYS-PRO-GLY-ILE-LYS-LYS-CYS-CYS-GLU-GLY-SER-CYS-GLY-MET-ALA-CYS-PHE-VAL-PRO-GLN
H-GLU-GLU-OH 3929-61-1
N-ALPHA-BENZOYL-L-ARGININE 7-AMIDO-4-METHYLCOUMARIN HYDROCHLORIDE 83701-04-6
Oxytocin 50-56-6
AC-IETD-CHO 191338-86-0
BENZYLOXYCARBONYL-L-LEUCYL-L-ARGINYLGLYCYLGLYCINE 4-METHYLCOUMARYL-7-AMIDE 167698-68-2
D-A2PR(NMA)-GLY-[PHE/ALA/VAL/GLU/ARG]-[PRO/TYR/LYS/ILE/ASP]-PHE-ALA-PHE-PRO-LYS(DNP)-D-ARG-D-ARG TRIFLUOROACETATE
N-Hydroxysuccinimide 6066-82-6
ANTI HUMAN GR COMMON
BOC-8-AMINO-3,6-DIOXAOCTANOIC ACID DCHA 560088-79-1
BOC-D-PHE-OH 18942-49-9
ANTI TOTAL GLUCAGON
ANTI-[PYR33]-PANCREASTATIN (PORCINE, 33-49)
PRODYNORPHIN (175-184) (HUMAN, PORCINE)
L-Carnosine 305-84-0
GLYCYL-L-PHENYLALANINE 3321-03-7
BIG ENDOTHELIN-3 (1-41) (HUMAN)
N-(3-DIMETHYLAMINOPROPYL)-N'-ETHYLCARBODIIMIDE HYDROCHLORIDE 7084-11-9
GLY-PRO-MCA TOSYLATE 67341-42-8
ANTI BASIC-FGF (1-9) (HUMAN)
ANTI-THYROID HORMONE RECEPTOR BETA-1
CALCISEPTINE 134710-25-1
(2R,3R)-2-Amino-3-methylpentanoic acid 319-78-8
ANTI PREPRORENIN (288-317) (HUMAN)
ANTI GALANIN (9-30) (HUMAN)
L-PYROGLUTAMYL-L-ARGINYL-L-THREONYL-L-LYSYL-L-ARGININE 4-METHYLCOUMARYL-7-AMIDE 155575-02-3
H-TYR-D-ALA-GLY-PHE-MET-NH2 61090-95-7
GASTRIN RELEASING PEPTIDE (HUMAN, 18-27) (HUMAN, PORCINE, CANINE)2ACOH 5H2O
AC-YVAD-AMC 149231-65-2
CRF (OVINE) 9015-71-8
BENZYLOXYCARBONYLGLYCYL-L-PROLYL-L-LEUCYLGLYCINE
NEUROPEPTIDE W-30 (HUMAN) 383415-80-3
AC-ARG-OME HCL 1784-05-0
BIG ENDOTHELIN-1 (1-31) (HUMAN, BOVINE) 133972-52-8
Z-PHE-TYR-OH
AC-WEHD-AMC 189275-74-9
D-Serine 312-84-5
BETA-NEOENDORPHIN 77739-21-0
ANTI GLP-2 (14-33) (RAT)
H-HIS-LEU-OH 7763-65-7
LEAP-2 (HUMAN)
ANTI-NEUROTENSIN
ANTI-CCK-33 (PORCINE)
(D-ARG0,HYP3,BETA-(2-THIENYL)-ALA5,8,D-PHE7)-BRADYKININ 103412-42-6
1 2 3 4 5 6 7 8 9 10

Copyright 2007©  ChemicalBook. All rights reserved.