ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
Interferon-Inducible T Cell α-Chemoattractant (human) 1927911-33-8
Interferon-Inducible T Cell α-Chemoattractant (mouse)
Interleukin 1? Converting Enzyme Substrate II
Interleukin Fragments and Related Peptides
Interleukin II (60-70)
Interleukin-6 Receptor (partial)
Intermedin (human) 1188922-20-4
Intermedin (rat) 1816940-00-7
Intermedin-53 (human) 1140977-96-3
Invertebrate Tachykinin-I, OctTK-I ??;KPPSSSEFIGLM-NH2
Ion Channel Modulators
Succinyl-(Glu9,Ala11,15)-Endothelin-1 (8-21) 142569-99-1
IRS1-derived peptide??;KKSRGDYMTMQIG-NH2
Isovaleryl-Phe-Lys-pNA · HCl 178894-43-4
Isovaleryl-Phe-Nle-Sta-Ala-Sta-OH 98092-14-9
Isovaleryl-Val-Val-Sta-OEt 120849-36-7
IV9 (476-484), HIV-1 RT Epitope ??;ILKEPVHGV
KALA Amphipathic Peptide
Lys-[Des-Arg9]-Bradykinin 71800-36-7
KEEAE 100929-96-2
Kemptide, amide 89315-28-6
Kemptide [LRRASLG];LRRASLG 65189-71-1
Kisspeptin-13 (human) 374675-18-0
Kisspeptin-54 (27-54) (human) 1135442-77-1
Kisspeptin-54 (human)
KK4A;KKGSVVIVGRIVLSGK
KL-1;LPPVAASSLRND
KR-12 (human) 1218951-51-9
K-R-Q-H-P-G
PKC Substrate Derived from EGF Receptor;KRTLRR 121284-21-7
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine
Lactoferricin B, fragment 4-14
Lactoferrin N-Lobe (231-245) (human) 169056-32-0
Lamprey PQRFamide
Lanreotide 108736-35-2
L-Anserine · nitrate 10030-52-1
LCMV gp33–41 151705-84-9
LEAP-2 (38-77) (Human)??;MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Leech Osmoregulatory Factor 175413-77-1
Lepirudin
Leptin: 116-130, mouse 258276-95-8
Leptin (126-140) (human) 313220-09-6
Leptin (138-167) (human) 313338-97-5
Leptin (150-167) (human) 200436-46-0
Leptin: 22-56, human 183598-56-3
Leptin Fragments and Related Peptides
Leptin Receptor Precursor;PFVK-pY-ATLISN
LEU-ARG
Leucomyosuppressin
Kemptide Negative Control
Ketolide resistance Peptide MRFFV
KGF Receptor Peptide 161338-76-7
Kinase Domain of Insulin Receptor (1);YETD-pY-YRKGGKGL
Insulin Receptor (1142-1153), pTyr1146;TRDI-pY-ETDYYRK
Kinase Domain of Insulin Receptor (3)
Kinase Domain of Insulin Receptor (4)
Insulin Receptor (1142-1153), pTyr(1146, 1150, 1151);TRDI-pY-ETD-pY-pY-RK
[pSer5]-Kemptide;LRRA-pS-LG
Kinetensin;IARRHPYFL 103131-69-7
Kisspeptin-13 (4-13) (human) 374675-21-5
LHRH, [D-Lys6]-
LHRH, [D-Ser(tBu)6,Aza-Gly10]-
Leucomyosuppressin (lms)
Leucopyrokinin (LPK)
Leucopyrokinin (4-8): Pheromonotropic Pentapeptide 104191-78-8
Leu-Enkephalin (sulfated) 80632-52-6
Leu-Enkephalin, amide 60117-24-0
Leukotriene A4 (LTA4) Hydrolase (365-385) (human)
Prodynorphin (228-256), porcine
Leupeptin 103476-89-7
Leu-pNA 4178-93-2
Leu-Valorphin-Arg 135861-77-7
Levitide;Pyr-GMIGTLTSKRIKQ-NH2 114281-19-5
LF 20 Consensus Peptide. Anthrax Related Lethal Factor;MLARRKKVYPYPMEPTIAEG-NH2
LHRH (1-2) (free acid) 32159-22-1
LHRH (1-4) (free acid) 77124-58-4
LHRH (1-5) (free acid) 52434-75-0
LHRH (1-5) hydrazide 51871-40-0
LHRH (1-5)-OMe
LHRH (1-6) (free acid) 103067-73-8
LHRH (1-6) amide 37783-55-4
LHRH (3-10) 38280-52-3
LHRH , [Des-Gly10, D-Leu6, Pro-NHEt9]-
LHRH II
LHRH, [D-Ala6]-
LHRH, [Des-Gly10,D-Ala6,Pro-NHEt9]-
LHRH, [Des-Gly10,D-His2,D-Ser(tBu)6,Pro-NHEt9]-
LHRH, [Des-Gly10,D-Ser(tBu)6,Pro-NHEt9]-
LHRH, [Des-Gly10,D-Trp6,Pro-NHEt9]-
LHRH, [Des-Gly10,Pro-NHEt9]-
LHRH, [D-Tle6,Pro-NHEt9]-
LHRH, [D-Trp6]-
LHRH-Ⅲ, lamprey
LHRH-III, lamprey
LIP1 (human) 1872435-03-4
LIP2 (human) 1872440-46-4
Lipotropin (61-91), human, ?-
Kemptide [LKRA-pY-LG], [Lys2, pY5];LKRA-pY-LG-NH2
L-Carnosine 305-84-0
DIPEPTIDE-1 70904-56-2
60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.