GL Biochem (Shanghai) Ltd회사는 제품 목록을 제공합니다.

회사 명:GL Biochem (Shanghai) Ltd

전화:21-61263452

이메일:ymbetter@glbiochem.com

국적:China

총 제품 수:9981

64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

제품 카탈로그

Oxytocin-2-fluoroethyl amide		C45H71FN12O12S2
Orphan GPCR SP9155 Agonist P518
OV - 2, Sheep
PAR-1-selective peptide??;TFLLRN
N-Me-Abz-Lys-Pro-Leu-Gly-OH	316364-29-1	C27H42N6O6
SFNGGP-NH2 PAR3 Tethered Ligand (Murine) / Activates PAR1 and PAR2	261521-21-5	C25H36N8O8
NTproBNP(1-76)
Obestatin (11-23) Rat, Mouse
p3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54–68)??;FEAKGAKANKAVD
Pancreatic Polypeptides (PP)
TFRGAP-NH2 PAR3 Tethered Ligand (Human) / Activates PAR1 and PAR2	1872435-09-0	C29H46N10O7
Osteopontin (131-137) (mouse)	577725-62-3	C35H58N10O10
Protease-Activated Receptor2(PAR2) Agonist??;SLIGRL-NH2	171436-38-7	C29H56N10O7
Neurotensin and Related Peptides
Nuclear Export Signal, NES, Dok-1 (348-359)??;LLKAKLTDPKED
Oxyntomodulin (bovine, dog, porcine)
PA (224–233), Influenza??;SSLENFRAYV	271573-27-4	C53H80N14O17
Neurotrophic Factor for Retinal Cholinergic Neurons	156707-52-7	C53H84N12O16
Noxiustoxin	143074-44-6
P55-TNFR Fragment;LPQIENVKGTED		C57H95N15O22
PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat;HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
p-Aminophenylacetyl Tuftsin	63147-94-4	C29H47N9O7
Orphanin FQ, (Nociceptin)		C79H129N27O22
Obestatin (Human, Monkey)
Parasin I	219552-69-9	C82H154N34O24
Osteocalcin (1-43)
OVA Peptide
Parathyroid Hormone (1-38), human	78232-94-7
Osteoblast-Adhesive Peptide	193613-75-1	C21H43N11O6
Orphan GPCR SP9155 Agonist P550 (mouse)	600171-70-8	C126H195N37O37
Parathyroid Hormone Related Peptide: 107-111	138949-73-2	C27H41N9O8
PAR-2(1-6) (human)	202933-49-1	C28H53N7O8
N-Me-Val-Leu-anilide	194351-54-7	C18H29N3O2
Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Ser-Asn-Lys-Ser-OH		C73H136N8O16S
NubO (68–75), Ndufa4 (68–75)??;VNVDYSKL
Obestatin, rat, mouse??;FNAPFDVGIKLSGAQYQQHGRAL-NH2
P62 (417-429), M. leprae??;LLQAAPALDKLKL
Pannexin-1 Fragment (4512)??;VQQKSSLQSESGN
[Gla17,21,24]-Osteocalcin (1-49);YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV(Gla=γ-CarboxyglutamicAcid:Disulfidebridge:23-29)	136461-80-8	C269H381N67O82S2
Orexin A, human
OVA (323-339);ISQAVHAAHAEINEAGR	92915-79-2	C74H120N26O25
NPF;KRS-pY-EEHIP		C51H80N15O19P
Nocistatin (bovine)	208253-85-4	C82H135N21O32
Obestatin (rat)	869705-22-6	C114H174N34O31
N-Me-Abz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide
Nuclear Factor NF-KB Inhibitor SN50
Oxytocin and Related Peptides
Pancreastatin (33-48) (human)
Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat)	155918-12-0	C27H42N10O7
PACAP-38 (human, mouse, ovine, porcine, rat)	137061-48-4	C203H331N63O53S1
Opiorphin	864084-88-8	C29H48N12O8
Nociceptin / Orphanin FQ
Oxytocin (free acid)	24346-32-5	C43H65N11O13S2
NFAT Inhibitor	249537-73-3	C75H118N20O22S
Peptide A (Tyrosine Kinase Inhibitor);VAPSDSIQAEEWYFGKITRRE	131023-24-0	C111H168N30O35
NPV??;FQQLFLNTL
N-n-Butyl-Val-Leu-anilide	282729-30-0	C21H35N3O2
PAR-2 (6-1) amide (mouse, rat)	245329-01-5	C29H56N10O7
Osteostatin (human)
OVA Peptide (257-264) - Amide
Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH	117858-54-5	C59H111N3O9S
Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Glu-Glu-Glu-Glu-OH		C77H136N6O21S
Orphanin FQ		C79H129N27O22
PAR-2 (1-6) (mouse, rat)	164081-25-8	C29H55N9O8
Orexins and Related Peptides
OV - 1, Sheep	326855-45-2	C105H188N34O21
Papilostatin-2
Nociceptin (1-13)-NH2/ Orphanin FQ	178064-02-3	C61H100N22O15
OVA Peptide (323-339)		C77H125N27O26
PACAP (6-27), amide, human, ovine, rat;FTDSYSRYRKQMAVKKYLAAVL-NH2		C121H193N33O31S
N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2	396716-07-7	C51H79N17O13
Protease-Activated Receptor-2, PAR-2 Agonist, amide;SLIGKV-NH2	190383-13-2	C28H54N8O7
PAR-1(1-6) (mouse, rat)		C37H54N10O9
Orphan GPCR SP9155 Agonist P518 (human)	600171-68-4	C127H195N37O37
Obestatin, human??;FNAPFDVGIKLSGVQYQQHSQAL-NH2	1081110-72-6	C116H176N32O33
PAR-2 (6-1) amide (human)		C28H54N8O7
Nociceptin (1-13) Amide, [Phe1-ψ(CH2-NH)-Gly2]-
Obestatin (11-23) Human
p34cdc2-derived peptide??;KVEKIGEGTYGVV-NH2
Pancreastatin [Tyr0], porcine
pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide;TSTEPQYQPGENL	198754-34-6	C62H94N16O25
Ovokinin	153512-29-9	C48H67N13O11
OVA (257-264);SIINFEKL	138831-86-4	C45H74N10O13
Osteogenic Growth Peptide (10-14)	105250-85-9	C24H29N5O7
PAR-3 (1-6) (human)	320347-28-2	C29H45N9O8
N-Me-Lys-Arg-Pro-Trp-Ile-Leu-OH		C35H56N10O6
P75-TNFR Fragment;SMAPGAVHLPQP		C53H85N15O15S
N-Succinyl-Ile-Ile-Trp-AMC	133525-12-9	C37H45N5O8
PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat)	138764-85-9	C47H83N17O11
Osteostatin amide (human)	204383-55-1	C142H229N43O57
OVA Peptide (323-339) - Amide
P69 (522-534), M. leprae??;PEKTAAPASDPTG
Orexin A, bovine, human, mouse, rat;Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2(Disulfidebridge:6-12and7-14)	205640-90-0	C152H243N47O44S4
Oxyntomodulin (human, mouse, rat)	159002-68-3	C192H295N61O60S
Parathyroid Hormone (1-34)-Lys(Biotin), human;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
Ophthalmic Acid	495-27-2	C11H19N3O6
PACAP 38, amide, frog;HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2		C204H333N63O53S
pTH (1-37) (human)	136799-54-7
PACAP (6-38), amide, human, ovine, rat;FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2	143748-18-9	C182H300N56O45S
Neurotensin, guinea pig		C76H119N21O21

64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100