ChemicalBook Chinese Germany Japanese Korean

吉尔生化(上海)有限公司 Company Information

Company Name:    GL Biochem (Shanghai) Ltd
Tel:    21-61263452
Email:    ymbetter@glbiochem.com
Nationality:    China
WebSite:    www.glschina.com/
Product List:    9981
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Product List
Urocortin III, human 357952-09-1
Urocortin III, mouse, free acid
Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide, Urodilatin, human;TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfidebridge:11-27) 115966-23-9
Tax8, HTLV-1 (12-19)??;LFGYPVYV
Tax9, HTLV-1 (11-19??;LLFGYPVYV
Urokinase substrate, Z-γ-Glu(tBu)-Gly-Arg-pNA
SV40 NLS??;PKKKRKVG
Syndyphalin SD-33 87636-57-5
Synapsin I-derived peptide??;LRRRLSDANF-NH2
Suc-Tyr-Val-Ala-Asp-AMC 201860-29-9
Tertiapin
Suc-Tyr-Leu-Val-pNA
Suc-Tyr-Val-Ala-Asp-pNA 208264-84-0
Suc-Val-Pro-Phe-pNA 95192-11-3
TIPP 146369-65-5
TACE (ADAM-17)
Thymic Humoral Gamma 2 Factor
TAT 697226-52-1
Thymopoietin II (33-36) 75957-56-1
Thymopoietin (TP) Fragments
TLCK 2364-87-6
Thymopoietin II (34-36) 75958-14-4
T Cell Activation Gene-3 (mouse)
TAT 2-4 1159916-66-1
Thymosin and Fragments
T-7 Peptide
Thymopoietin I/II (29-41) (bovine) 56795-64-3
Thymopoietin II (32-36)-ethyl ester 283167-49-7
Tachyplesin I
TIP 39, Tuberoinfundibular Neuropeptide;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 277302-47-3
TGF α (1-50) (rat)
Thymosin α1 (deacetylated) (human, bovine, mouse, rat)
TPCK 402-71-1
Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Thymus and Activation-Regulated Chemokine (human) 439555-96-1
Tos-Gly-Pro-Lys-pNA 73392-19-5
TNF - α (72 - 82), human
TRAP-5
TRAP-14 amide 141923-36-6
Thrombin Receptor Agonist (FLLRN);FLLRN 141136-84-7
Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine)
Thymosin β4 (16-38)
Thymosin b4 (16-38) 113318-05-1
Thrombin Receptor (42-48) Agonist, human;SFLLRNP 145229-76-1
Thrombospondin Analog 143740-28-7
TNF-α(78-96) (human)
T-F-Q-A-Y-P-L-R-E-A 117592-22-0
Thrombin Receptor Agonist,amide (SFLLR-NH2);SFLLR-NH2 141923-41-3
Thymosin β4 (human, bovine, horse, rat)
Transduction Peptide 1 (α II) Cat #:86740
Thymosin β10 (human, rat) 88160-82-1
Thymosin-α1
Tos-Gly-Pro-Arg-AMC · HCl 117961-27-0
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78)
Thrombin (B 147-158) (human) 207553-42-2
TIMP-2 (145-168) (human, bovine) 1872435-10-3
TNF-α(71-82), human
Tos-Gly-Pro-OH 100723-71-5
Tos-Gly-Pro-Lys-AMC 128202-25-5
Thymosin-α1, [Ac-Tyr0]-
Transforming Growth Factor β1 Peptide, TGF - β1 (60 - 66), amide
Thrombin Receptor Activator for Peptide 6 (TRAP-6);SFLLRN 141136-83-6
Urocortin III, mouse 357952-10-4
Tyr-α-CGRP (23-37) (canine, mouse, rat)
Tyr-Leptin (26-39) (human) 309247-25-4
TRH 40216-95-3
Tyr-PDGF A-Chain (194-211) 137132-69-5
Tyrosinase (243-251) (human) 197171-78-1
TRH-βNA
uPAR (84-95) (human)
Tyr-Amyloid P Component (27-38) amide 198268-71-2
Urinary Trypsin Inhibitor Fragment 164859-77-2
Tyrosinase (192-200)??;SEIWRDIDF 170294-35-6
TRH-AMC 190836-86-3
Tyr-α-CGRP (human) 124756-98-5
Tyr-(Glu1)-Sauvagine
Tuftsin 72103-53-8
Type B Allatostatin
Tyr-Big Endothelin-1 fragment (22-38) (human) 348128-18-7
Tyr0-Secretin (Porcine)
Tyr-Proinsulin C-Peptide (55-89) (human)
Tritrpticin 179264-81-4
TRAP-6 amide
Urechistachykinin I
Tropoelastin Fragment
Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) 185032-24-0
Tyr-ACTH (4-9) 129813-57-6
Tripeptide-2 64577-63-5
Uperolein
Tyr-Uroguanylin (rat)
Tyr-Specific Protein Kinase Inhibitor
Pentapeptide-1 69558-55-0
TRAP-7
Thyrotropin Releasing Hormone Precursor Peptide: TRH Precursor Peptide;KRQHPGKR
Thyrotropin Releasing Hormone, free acid: TRH, free acid;Pyr-HP 34367-54-9
Urocortin II, human 398001-88-2
Trypanothione
Tyrosine Protein Kinase JAK 2;VLPQDKE-pY-pY-KVKEPGE
Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) 496849-46-8
TTA-386 152847-08-0
69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100

Copyright 2007©  ChemicalBook. All rights reserved.