BOC Sciences

BOC Sciences

Current Location: HOME >> Product
Product Categories
BOC Sciences
Country: United States
Tel:
Mobile: 6314854226
E-mail:
QQ:
Skype: Chat Now!
Product Name MF CAS Details
Receptor tyrosine-protein kinase erbB-2 precursor (369-386) Details
Receptor tyrosine-protein kinase erbB-2 (689-697) Details
Retinal dehydrogenase 1 (88-96) Details
Ribosomal protein S26 (47-61) Details
Rho-related GTP-binding protein RhoC (176-185) Details
Receptor tyrosine-protein kinase erbB-2 (952-961) Details
Regulator of G-protein signaling 5 (74-83) Details
Rho guanine nucleotide exchange factor 17 (425-438) Details
Receptor tyrosine-protein kinase erbB-2 (754-762) Details
RER1 protein (80-91) Details
Regulator of G-protein signaling 5 (5-13) Details
Rhodopsin Epitope Tag C??H??N??O?? Details
TAG-1 A2 (78-86) Details
Telomerase reverse transcriptase (461-469) Details
Survivin (80-88) Details
Telomerare Reverse Transcriptase (hTRT) (653-661) Details
Telomerase reverse transcriptase (672-686) Details
SYSMEHFRWGKPS C??H???N??O??S Details
Telomerase reverse transcriptase (540-548) Details
Telomerase reverse transcriptase (865-873) Details
Telomerase Reverse Transcriptase (674-683) Details
TDSP5 Details
TAMRA-β-Amyloid (1-42), human 1802087-80-4 Details
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT)) Details
Talin (777-785) Details
Telomerase reverse transcriptase (766-780) Details
TAG-2 (42-50) Details
Serine/threonine-protein kinase B-raf (586-614) Details
Serine protease hepsin (191-199) Details
Small nuclear ribonucleoprotein Sm D1 (11-19) Details
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Details
Secernin-1 (196-204) Details
Structure-specific endonuclease subunit SLX4 (603-615) Details
Survivin (18-27) Details
Siyry C50H71N11O13 178561-37-0 Details
Serine/threonine-protein kinase mTOR (89-98) Details
SSA protein SS-56 (55-64) Details
Secretin (5-27) (Porcine) C115H200N38O34 19665-15-7 Details
Serine protease hepsin (268-276) Details
STh C79H112N22O30S6 118447-40-8 Details
Sodium-coupled monocarboxylate transporter 2 (343-356) Details
Surface IgG (sA20-Ig) of A20 (106-114) Details
Serine protease hepsin (229-237) Details
St-Ht31 P C127H209N29O39 252869-81-1 Details
Sperm surface protein Sp17 (103-111) Details
Sarcoma antigen 1 (715-723) Details
Small subunit processome component 20 homolog (626-634) Details
Survivin-3A (96-104) Details
Ribosome-binding protein 1 (879-887) Details
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid C10H12O3 458528-68-2 Details
RPL8 protein (31-41) Details
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid C10H12O3 458528-71-7 Details
Protein SSX2 (45-58) Details
Protein enabled homolog (443-451) Details
Protein SSX2 (41-49) Details
Protein SSX2 (101-111) Details
Prostatic acid phosphatase (18-26) Details
Protein SSX4 (151-170) Details
Protein SSX2 (45-59) Details
Prostatic acid phosphatase (112-120) Details
Protein SSX2 (37-54) Details
Protein SSX2 (19-34) Details
Protein OS-9 (438-446) Details
Protein enabled homolog (502-510) Details
Protein phosphatase 1 regulatory subunit 3B (172-180) Details
Prostatic acid phosphatase (299-307) Details
Rabenosyn-5 (541-552) Details
Putative protein product of HMFN1045 (253-264) Details
Receptor tyrosine-protein kinase erbB-2 (369-377) Details
Receptor tyrosine-protein kinase erbB-2 (654-662) Details
Receptor-type tyrosine-protein kinase FLT3 (591-600) Details
Protein SSX4 (31-50) Details
PSMA-PEG4 C23H42N4O12 2256069-92-6 Details
Receptor-type tyrosine-protein phosphatase kappa (667-682) Details
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid C10H12O3 1932808-80-4 Details
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid C10H12O3 374119-33-2 Details
PSMA (27-38) Details
Ras-related protein Rab-38 (50-58) Details
PSMA/PSM-P1 (4-12) Details
[pThr3]-CDK5 Substrate C53H100N15O15P 1670273-47-8 Details
Receptor tyrosine-protein kinase erbB-2 (1023-1032) Details
Receptor tyrosine-protein kinase erbB-2 (63-71) Details
Receptor tyrosine-protein kinase erbB-2 (391-399) Details
Protein timeless homolog (848-856) Details
Protein SSX4 (61-80) Details
Receptor tyrosine-protein kinase erbB-2 (466-474) Details
PSM P2 (711-719) Details
Protein SSX4 (51-70) Details
Protein SSX4 (41-60) Details
Ras-related protein Rab-27A (178-186) Details
Receptor tyrosine-protein kinase erbB-2 (435-443) Details
Receptor tyrosine-protein kinase erbB-2 (650-658) Details
Proto-oncogene PIM1 (191-199) Details
Receptor tyrosine-protein kinase erbB-2 (48-56) Details
Protein SSX4 (161-180) Details
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153 C72H110N19O33P3 141171-54-2 Details
Receptor tyrosine-protein kinase erbB-2 (402-410) Details
Receptor tyrosine-protein kinase erbB-2 (5-13) Details
PSCA (14-22) Details
Receptor tyrosine-protein kinase erbB-2 (665-673) Details
Product Total: Product Page:
154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198