GL Biochem (Shanghai) Ltd

GL Biochem (Shanghai) Ltd

Current Location: HOME >> Product
Product Categories
Country: China
Tel: 21-61263452
Mobile: 13641803416
E-mail:
QQ:
Skype: Chat Now!
Company Name:Shanghai GL Peptide Ltd
Tel:86-21-61263385
Fax:86-21-61263399
Email:ymbetter@glbiochem
WebSite:http://www.glbiochem.com
Nationality:CHINA
Product Name MF CAS Details
Peptide 6A C23H43N9O6 73549-32-3 Details
Pentagastrin 50 μg/vial (Clinalfa basic) Details
Proinsulin (31-65), human, Tyr- Details
Prolactin Releasing Peptides and Related Peptides Details
Pep1-AGL C40H69N11O14S Details
Prepro-ANF: 104-116, human C61H113N21O20 Details
Prepro-Neuromedin S (70-103) (human) 894454-10-5 Details
Prodynorphin: 228-256 Details
Protease Substrates Details
Polistes Mastoparan C77H127N21O18 74129-19-4 Details
Pro-Adrenomedullin (12-20) human;KWNKWALSR-NH2 C56H86N18O11 186027-43-0 Details
pp60C-SRC Carboxy-Terminal Phosphoregulatory Peptide, Phosphorylated;TSTEPQ-pY-QPGENL C62H95N16O28P 149299-77-4 Details
Prion Protein (118-135) (human) C68H112N18O22S2 202121-03-7 Details
Prion Protein (106 - 126) Details
Prepro-CNP: 1-27, rat C87H153N33O29 Details
PLP 41-58 Details
Preptin (rat) 315197-73-0 Details
Prosaptide TX14(A) C69H110N16O26 196391-82-9 Details
PrP (106-126);KTNMKHMAGAAAAGAVVGGLG C80H138N26O24S2 148439-49-0 Details
Pep2m C49H92N18O13S 243843-42-7 Details
Pep4c C48H91N17O13S 243843-43-8 Details
Procollagen Type I (212-216) C23H45N7O9 149128-48-3 Details
Pro-Adrenomedullin: 153-185, human Details
Prepro-Atrial Natriuretic Factor (104-123) (human) C94H171N31O28 112160-83-5 Details
Presenilin-1 (331-349)-Cys (human, mouse) C92H130N28O37S 317335-35-6 Details
Prepro-Nerve Growth Factor (99-115) (mouse) C89H139N27O26 Details
Peptide 810 C59H91N13O17S 156371-22-1 Details
PLM derived peptide??;IRRLSTRRR-OH Details
Prolactin Releasing Peptide (1-31), HumanPrRP-31 Details
Propionyl-Amyloid β-Protein (31-34) amide Details
Peptide M C81H141N21O31 110652-62-5 Details
Preproenkephalin B (186-204), human C78H115N21O36S Details
TRH-Potentiating Peptide C54H75N11O18S Details
PB1(703-711), Influenza??;SSYRRPVGI Details
proFIX18??;TVFLDHENANKILNRPKR Details
Prolactin Releasing Peptide-31 (24-31), bovine: PrRP- Details
PDGF Antagonist C77H122N20O17 143784-00-3 Details
Peptide 46 C100H174N40O31 192122-40-0 Details
Peptide B, bovine C163H239N39O53S2 Details
PKC (530-558);LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2 C148H221N35O50S2 122613-29-0 Details
Preangiotensinogen (11-14) (human) Details
pro-ε-Tx1X/12??;LKRTIRTRLNIR Details
Prosaptide, wild type Details
Preprogalanin 28-67, rat Details
Pompilidotoxin, ?- C71H124N22O17 216064-36-7 Details
Prepro VIP/PHM: 111-122 C53H87N13O21 Details
Prepro VIP: 81-122, human Details
PEP1;SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 C177H259N43O49S Details
Platelet-Derived Growth Factor Receptor Substrate 2;SVL-pY-TAVQPNE C54H86N13O22P Details
pTH (1-44) (human) C225H366N68O61S2 85568-24-7 Details
Proadrenomedullin N-terminal 20 Peptide (Human, 9-20) C77H119N25O14 Details
Polylysine C6H14N2O2 25104-18-1 Details
Parathyroid Hormone (PTH) and Related Peptides Details
PLP 184-199 Details
Prolactin Releasing Peptide-20 (PrRP-20), bovine Details
proPT18??;HVFLAPQQARSLLQRVRR Details
Prolactin Releasing Peptide (1-31), rat;SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 C28H24N4O5 215510-06-8 Details
Peptide 74 C62H107N23O20S2 Details
Prolactin Releasing Peptide (1-31), human;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 C104H158N32O26 235433-36-0 Details
Prepro Corticotropin Releasing Factor (125-151), human C115H188N40O42 Details
Pneumadin (rat) C47H74N12O15 130918-90-0 Details
Pro-Cortistatin (51-81) Details
Prion Protein (106-126) (human) (scrambled) C80H138N26O24S2 150469-23-1 Details
Pep1-TGL C41H71N11O15S Details
PKI Inhibitor (6-22), amide;TYADFIASGRTGRRNAI-NH2 C80H130N28O24 121932-06-7 Details
Peptide F, bovine C172H259N41O53S3 Details
PDGF β-Receptor (719-723) (phosphorylated) Details
proFIX28??;TVFLDHENANKILNRPKRYNSGKLEEFV Details
Prolactin Releasing Peptide-31 (PrRP-31), bovine Details
Pol-RFamide C36H57N11O8 119116-89-1 Details
Pre-S2 (1-26) C131H199N39O37S 104753-45-9 Details
Protein G B1 Domain (41-56) C83H118N18O31 160291-75-8 Details
Prolactin Releasing Peptide (12-31), rat;TPDINPAWYTGRGIRPVGRF-NH2 C104H158N32O26 222988-10-5 Details
Pep2-SVKI C60H93N13O18 328944-75-8 Details
Prepro-adrenomedullin (153-185), human;SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL Details
Procollagen α1 (1187-1218) (human) Details
Protease - Activated Receptor2 Details
Platelet-Derived Growth Factor ?-Receptor (739-746);pY-MAPYDNY C48H62N9O18PS Details
Pro-Cortistatin (28-47) C79H129N23O33 Details
Pep2-SVKE C59H89N13O20 1315378-76-7 Details
Pre-S1 (12-32) C104H154N26O31S Details
Prepro-TRH (178-199) C116H176N28O39S 122018-92-2 Details
Pep2-EVKI C62H95N13O19 1315378-67-6 Details
Polyphemusin II-Derived Peptide C90H141N33O18S2 229030-20-0 Details
Prolactin Releasing Peptide (1-31), bovine;SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 Details
Procathepsin B (36-50) (rat) C71H123N19O18S 317331-26-3 Details
Procathepsin B (26-50) (rat) C123H198N34O33S 317331-27-4 Details
Pedibin Precursor (hydra) C228H369N61O86S Details
PLP 190-209 Details
Prepro-Neuromedin U (104-136) (human) Details
proPT28??;HVFLAPQQARSLLQRVRRANTFLEEVRK Details
Pep2-AVKI C60H93N13O17 1315378-69-8 Details
Pep 4AK;KKKGSVVIVGRIILSGR-NH2 C81H153N27O19 Details
Parathyroid Hormone (1-34), bovine;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF C183H288N54O50S2 12583-68-5 Details
Peptide F (22-34) (bovine, ovine) C61H95N17O17S 88878-74-4 Details
Prepro VIP/PHM: 156-170 C71H106N16O31 107902-86-3 Details
pTH (28-48) (human) C95H150N28O29 83286-22-0 Details
Prolactin Releasing Peptide (12-31), bovine;TPDINPAWYAGRGIRPVGRF-NH2 C103H156N32O25 Details
Prepro TRH (53-74) C118H182N32O32 Details
pTH (1-38) (human) 104218-12-4 Details
Product Total: Product Page:
49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100