ChemicalBook
Chinese english Germany Japanese Korea

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Produkt Beschreibung

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Struktur
133514-43-9
CAS-Nr.
133514-43-9
Englisch Name:
ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
Synonyma:
EXENDIN (9-39);EXENDIN 3 (9-39);EXENDIN (9-39) AMIDE;EXENDIN FRAGMENT 9-39;EXENDIN [9-39] PEPTIDE;EXENDIN-3 (9-39) AMIDE;Exendin (9-39) Acetate;Exendin 4 (9-39) amide;Exendin FragMent 9-39Exendin;M.W. 3369.79 C149H234N40O47S
CBNumber:
CB0109941
Summenformel:
C149H234N40O47S
Molgewicht:
3369.76
MOL-Datei:
133514-43-9.mol

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Eigenschaften

Dichte
1.51
RTECS-Nr.
LF2460000
storage temp. 
−20°C
Wasserlöslichkeit
Soluble in water at 1mg/ml
InChIKey
WSEVKKHALHSUMB-UHFFFAOYSA-N

Sicherheit

WGK Germany  3

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

Biological probe.

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 64)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
GenicBio Limited
+86-21-37621270
+86-21-67621877 service@genicbio.com CHINA 991 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Nanjing Chemlin Chemical Co., Ltd 025-83697070
+86-25-83453306 sales@chemlin.com.cn China 19977 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Shanghai LiuShi Pharmaceutical Technology Co., Ltd. 021-60135539
021-38721356 shlschemical@hotmail.com China 9915 55

  • ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
  • EXENDIN 3 (9-39)
  • EXENDIN-3 (9-39) AMIDE
  • EXENDIN (9-39)
  • EXENDIN (9-39) AMIDE
  • EXENDIN [9-39] PEPTIDE
  • EXENDIN FRAGMENT 9-39
  • DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
  • M.W. 3369.79 C149H234N40O47S
  • Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
  • 9-39-Exendin 3(Heloderma horridum)
  • H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
  • Exendin FragMent 9-39Exendin
  • H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
  • 9-39-Exendin 3(Heloderma horridum) (9CI)
  • Exendin (9-39) Acetate
  • Exendin 4 (9-39) amide
  • 133514-43-9
  • C149H234N40O47S
  • C149H234N40O47S1
  • BioChemical
  • Cell Biology
  • Cell Signaling and Neuroscience
  • Hormones
  • Obesity Research
  • Exendin
  • Cytokines, Growth Factors and Hormones
  • Peptide
  • GLP-1 Receptor LigandsObesity Research
  • Cytokines Growth Factors and Hormones (Obesity)
  • ExendinPeptides for Cell Biology
  • Hormones
  • Obesity Peptides
  • Obesity Research
  • Other Obesity Research Products
  • Glucagon receptor and related
Copyright 2019 © ChemicalBook. All rights reserved