ChemicalBook
Chinese english Germany Japanese Korea

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Produkt Beschreibung

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Struktur
107444-51-9
CAS-Nr.
107444-51-9
Englisch Name:
GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN
Synonyma:
GLP-17-3;GLP-1 [7-36];Glp-I (7-36);GLP-1-(7-36) amide;GLP-1(7-36) acetate;GLP-1 (7-36) or (7-37);Human GLP-1 (7-36)-NH2;GLP-1(7-37), IRP peptide;GLP-1 (7-36) AMIDE (HUMAN);GLP-1 (7-36) amide Acetate
CBNumber:
CB1335109
Summenformel:
C149H226N40O45
Molgewicht:
3297.63
MOL-Datei:
107444-51-9.mol

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Eigenschaften

Dichte
1.47
RTECS-Nr.
LZ3980060
storage temp. 
−20°C
Aggregatzustand
powder
Wasserlöslichkeit
Soluble in water (1 mg/ml).
InChIKey
DTHNMHAUYICORS-KTKZVXAJSA-N

Sicherheit

WGK Germany  3

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

Diabetes?II?-?not?yet?an?approved?application

GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 77)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Nanjing ChemLin Chemical Industry Co., Ltd.
025-83697070;product@chemlin.com.cn
product@chemlin.com.cn CHINA 3015 60
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30001 58
Chengdu Biopurify Phytochemicals Ltd.
18080483897
maggie@biopurify.com CHINA 2258 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 35440 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
Creative Peptides
info@creative-peptides.com United States 6249 56
Nanjing Peptide Biotech Ltd. 18751911884
025-58361107-806 liugang@njpeptide.com China 9953 55
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69

  • GLP-1(7-36),Glucagon-Like Peptide I Amide Fragment 7-36 human
  • GLP-1(7-36)/Glucagon-like peptide 1 (7-36) aMide (huMan, rat)
  • GLP-17-3
  • HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2
  • H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2
  • HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
  • GLP-1 [7-36]
  • GLP-1 (7-36) AMIDE (HUMAN)
  • GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT
  • GLP-1 (HUMAN, 7-36 AMIDE) (BOVINE, CANINE, RAT, GUINEA PIG)
  • GLUCAGON-LIKE PEPTIDE-1 [7-36]
  • GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN
  • GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN)
  • GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT
  • GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, RAT, MOUSE)
  • GLUCAGON LIKE PEPTIDE-I (7-36) AMIDE, HUMAN
  • GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-36 AMIDE) (BOVINE, CANINE, RAT, GUINEA PIG)
  • glucagon-like peptide i amide fragment 7-36 human
  • GLP-1(7-36) acetate
  • GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT)
  • GLP-1 (7-36) amide (human, bovine, gp, mouse, rat)
  • M.W. 3297.67 C149H226N40O45
  • GLP-1-(7-36) amide
  • Glp-I (7-36)
  • Glucagon-related peptide 1 (rana catesbeiana), 3-L-glutamic acid-10-L-valine-16-glycine-17-L-glutamine-23-L-isoleucine-24-L-alanine-27-L-valine-30-L-argininamide-31-de-L-proline-32-de-L-lysine-
  • GLP-1 (7-36) or (7-37)
  • Glucagon-like peptide 1 (7-36) amide (human, rat)
  • GLP-1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat) Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-127) aMide (huMan, bovine, guinea pig, Mouse, rat), Proglucagon (78-107) aMide (huMan, bovine, guin
  • Glucagon-like peptide 1 (7-36) (huMan, rat, Mouse)
  • Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), Preproglucagon (98-127) aMide (huMan, bovine, guinea pig, Mouse, rat), Proglucagon (78-107) aMide (huMan, bovine, guinea pig, Mouse, rat)
  • H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 acetate salt
  • GLP-1 (7-36) amide Acetate
  • GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)|GLP-1 (7-36) amide(P1269)
  • PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT
  • PREPROGLUCAGON 78-107 AMIDE
  • PREPROGLUCAGON (78-107) AMIDE (HUMAN)
  • PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT
  • glucagon-likepeptidei(7-36
  • Human GLP-1 (7-36)-NH2
  • GLP-1(7-37), IRP peptide
  • Glucagon-Like Peptide (GLP) I (7-36), amide, human
  • 107444-51-9
  • C149H226N40O45
  • Cytokines, Growth Factors and Hormones
  • Other Protein/Peptide Hormones
  • Hormones
  • Cell Signaling and Neuroscience
  • Cell Biology
  • BioChemical
  • -
  • Peptide
  • Glucagon receptor and related
Copyright 2019 © ChemicalBook. All rights reserved