ChemicalBook
Chinese english Germany Japanese Korea

CRF (HUMAN, RAT) Produkt Beschreibung

CRF (HUMAN, RAT) Struktur
86784-80-7
CAS-Nr.
86784-80-7
Englisch Name:
CRF (HUMAN, RAT)
Synonyma:
CRH;CRF;crf41;mci028;ratcrf;humancrf;corticobiss;ratcrf(1-41);CRF Acetate;humancrf(1-41)
CBNumber:
CB1777095
Summenformel:
C208H344N60O63S2
Molgewicht:
4757.45
MOL-Datei:
Mol file

CRF (HUMAN, RAT) Eigenschaften

storage temp. 
−20°C
Aggregatzustand
White to off-white lyophilized solid

Sicherheit

WGK Germany  3
RTECS-Nr. GM7925000
10

CRF (HUMAN, RAT) Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

Treatment of symptoms associated with peritumoral edema in brain tumor patients.

Trademarks

Xerecept (Hollister-Stier) [Note—The source of the product (human, porcine, etc.) must be indicated in the labeling.].

CRF (HUMAN, RAT) Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


CRF (HUMAN, RAT) Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 87)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
Hubei xin bonus chemical co. LTD
86-13657291602
027-59338440 sales@guangaobio.com CHINA 23049 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
J & K SCIENTIFIC LTD. 400-666-7788 +86-10-82848833
86-10-82849933 jkinfo@jkchemical.com;market6@jkchemical.com China 96815 76
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
Arden pharmaceutical &chemical Co., Ltd +86-(0)533-3595900 13793319233
+86-(0)533-3595900 info@chems.com.cn China 669 61
Alabiochem Tech.Co., Ltd. 0086-512-58900862; 400-0707-518; 0086-512-56727736
0086-512-56765862 sales@alabiochem.com China 995 59
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50

86784-80-7()Verwandte Suche:


  • Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem
  • corticobiss
  • corticotropin-releasingfactor(horse)
  • corticotropin-releasingfactor(rat)
  • corticotropin-releasingfactor(sheep),2-l-glutamicacid-22-l-alanine-23-l-arg
  • corticotropin-releasinghormone(human)
  • crf41
  • humancorticotropin-releasingfactor
  • humancorticotropin-releasinghormone
  • humancorticotropin-releasinghormone-41
  • humancrf
  • humancrf(1-41)
  • inine-25-l-glutamicacid-38-l-methionine-39-l-glutamicacid-41-l-isoleucinamid
  • mci028
  • ratacth-releasinghormone
  • ratcorticotropin-releasingfactor
  • ratcorticotropin-releasingfactor-41
  • ratcrf
  • ratcrf(1-41)
  • rathypothalamiccrf
  • CRF(human,Rat) Acetate
  • Ser-Glu-Glu-Pro-Pro-IleSer-Leu-Asp-Leu-Thr-Phe-His-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
  • SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
  • CORTICOTROPIN RELEASING FACTOR
  • CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT
  • CORTICOTROPIN RELEASING FACTOR, HUMAN
  • CORTICOTROPIN RELEASING FACTOR, HUMAN AND RAT
  • CORTICOTROPIN RELEASING FACTOR HUMAN, RAT
  • CRF, HUMAN AND RAT
  • CRF (HUMAN, RAT)
  • CRH
  • CRF
  • H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
  • Corticotropin-releasing factor (human) (Human CRF)
  • CRF (human, rat) acetate salt
  • M.W. 4757.45 C208H344N60O63S2
  • Rat/human corticotropin-releasing factor
  • Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-
  • CRF (huMan, rat) CRF-41, CRH, Corticoliberin, Corticorelin
  • CRF-41, CRH, Corticoliberin, Corticorelin
  • CorticotropinReleasingFactorhuMan,rat,CorticotropinReleasingFactorhuMan
  • H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 acetate salt
  • CRF Acetate
  • CRF(human,rat), CRH
  • Corticotropin-releasing Factor TFA Salt (Human, rat) (Technical Grade)
  • 86784-80-7
  • C208H344N60O63S2
  • BioChemical
  • Amino Acids and Peptides
  • Biochemicals and Reagents
  • Releasing Factors
  • Peptides
  • Peptide
  • CRF receptor and related
  • proteins
Copyright 2019 © ChemicalBook. All rights reserved