ChemicalBook
Chinese english Germany Japanese Korea

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Produkt Beschreibung

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Struktur
137061-48-4
CAS-Nr.
137061-48-4
Englisch Name:
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
Synonyma:
Pacap;ADCYAP1;PACAP-38;Peptide pacap;PACAP 38, OVINE;PACAP-38 HUMAN, SHEEP;PACAP-38 (HUMAN, OVINE, RAT);PACAP (1-38), HUMAN, OVINE, RAT;PACAP (1-38) (HUMAN, SHEEP, RAT);PACAP (1-38), AMIDE, HUMAN, OVINE, RAT
CBNumber:
CB5698835
Summenformel:
C203H331N63O53S1
Molgewicht:
4534.26
MOL-Datei:
Mol file

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Eigenschaften

RTECS-Nr.
TO7345000
storage temp. 
−20°C
Aggregatzustand
White to off-white solid

Sicherheit

WGK Germany  3

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Chemische Eigenschaften,Einsatz,Produktion Methoden

Biologische Aktivität

Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). Potently stimulates adenylyl cyclase.

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 53)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30001 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Beijing Yibai Biotechnology Co., Ltd
0086-182-6772-3597
sales01@yibaibiotech.com CHINA 410 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 35440 58
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
Alabiochem Tech.Co., Ltd. 0086-512-58900862; 400-0707-518; 0086-512-56727736
0086-512-56765862 sales@alabiochem.com China 995 59
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Aladdin Bio-Chem Technology Co.,LTD 021-20337333/400-620-6333
021-50323701 sale@aladdin-e.com China 24986 65

137061-48-4()Verwandte Suche:


  • ANTI-ADCYAP1 (C-TERM) antibody produced in rabbit
  • H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
  • ADENYLATE CYCLASE ACTIVATING PEPTIDE-38
  • ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38
  • PACAP (1-38), AMIDE, HUMAN, OVINE, RAT
  • PACAP (1-38), HUMAN, OVINE, RAT
  • PACAP (1-38) (HUMAN, SHEEP, RAT)
  • PACAP-38
  • PACAP-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT)
  • PACAP-38 (HUMAN, OVINE, RAT)
  • PACAP-38 HUMAN, SHEEP
  • PACAP 38, OVINE
  • PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (1-38), HUMAN, OVINE, RAT
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 38 (HUMAN) OVINE, RAT
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 38 HUMAN, SHEEP
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 38, OVINE
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (HUMAN, OVINE, RAT)
  • PITUITARY ADENYLATE CYCLASE-ACTIVATING P EPTI DE (1-27) PACAP (1-27
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-3
  • pituitary adenylate cyclase activating polypeptide-38
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE 38 (OVINE, RAT)
  • PITUITARY ADENYLATE CYCLASE-ACTIVATING PEPTIDE
  • Pacap
  • Peptide pacap
  • Pituitary adenylate cyclase activating polypeptide-38Pituitary adenylate cyclase activatin
  • Pituitary adenylate cyclase activating polypeptide-38 (PACAP-38)
  • ADCYAP1
  • PACAP 38, Ovine - CAS 137061-48-4 - Calbiochem
  • 137061-48-4
  • C203H331N63O53S
  • Cell Signaling and Neuroscience
  • Cell Biology
  • Adenylyl Cyclase Activators
  • BioChemical
  • G Proteins and Cyclic Nucleotides
  • Cyclic Nucleotide Metabolism
  • 兔抗人、大、小鼠PACAP-38多克隆抗体
  • 多肽抗原
  • Peptide
Copyright 2019 © ChemicalBook. All rights reserved