ChemicalBook
Chinese english Germany Japanese Korea

Nesiritide acetate Produkt Beschreibung

Nesiritide acetate Struktur
114471-18-0
CAS-Nr.
114471-18-0
Englisch Name:
Nesiritide acetate
Synonyma:
BNP-32;Fam-BNP;Nesirtide;BNP HUMAN;BNP-32 (HUMAN);BNP (1-32), HUMAN;NESIRITIDE ACETATE;natriureticpeptide,brain;BRAIN NATRIURETIC PEPTIDE;Natriuretic factor, brain
CBNumber:
CB8676346
Summenformel:
C143H244N50O42S4
Molgewicht:
3464.04
MOL-Datei:
114471-18-0.mol

Nesiritide acetate Eigenschaften

storage temp. 
−20°C
Aggregatzustand
powder
CAS Datenbank
114471-18-0(CAS DataBase Reference)

Sicherheit

WGK Germany  3

Nesiritide acetate Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

hemostatic, antimicrobial

Nesiritide acetate Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


Nesiritide acetate Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 125)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Shenzhen Sendi Biotechnology Co.Ltd.
0755-23311925 18102838259
0755-23311925 Abel@chembj.com CHINA 3202 55
Henan DaKen Chemical CO.,LTD.
+86-371-55531817
info@dakenchem.com CHINA 21759 58
Henan Tianfu Chemical Co.,Ltd.
0371-55170693
0371-55170693 info@tianfuchem.com CHINA 20672 55
Mainchem Co., Ltd.
+86-0592-6210733
+86-0592-6210733 sales@mainchem.com CHINA 32447 55
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 27142 58
Chengdu Biopurify Phytochemicals Ltd.
18080483897
maggie@biopurify.com CHINA 2236 58
Chemwill Asia Co.,Ltd.
86-21-51086038
86-21-51861608 chemwill_asia@126.com;sales@chemwill.com;chemwill@hotmail.com;chemwill@gmail.com CHINA 23964 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28237 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Arden pharmaceutical &chemical Co., Ltd +86-(0)533-3595900 13793319233
+86-(0)533-3595900 info@chems.com.cn China 669 61

114471-18-0()Verwandte Suche:


  • BNP-32
  • BNP-32 (HUMAN)
  • BNP (1-32), HUMAN
  • H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH
  • H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26)
  • NESIRITIDE ACETATE
  • SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS
  • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26)
  • Nesiritide Acetate (BNP-32)
  • BRAIN NATRIURETIC PEPTIDE, PORCINE SYNTH ETIC >97%
  • BRAIN NATRIURETIC PEPTIDE
  • atrial natriuretic peptide, 1-32, human
  • Brain natriuretic factor【human】
  • Brain natriuretic factor-32【human】
  • Human brain natriuretic peptide-32
  • Nesiritide Acetate (BNP-32) Brain Natriuretic Pept
  • natriureticpeptide,brain
  • BRAIN NATRIURETIC PEPTIDE, HUMAN
  • BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN
  • Natriuretic factor, brain
  • Nesirtide
  • Fam-BNP
  • brain natriuretic peptide-32
  • BRAIN NATRIURETIC PEPTIDE-32 (HUMAN)
  • BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN)
  • B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN)
  • BNP HUMAN
  • 114471-18-0
  • C143H244N50O42S4
  • Amino Acids and Peptides
  • Biochemicals and Reagents
  • BioChemical
  • Natriuretic Peptides
  • Peptides
  • Amino Acid Derivatives
  • Peptide
  • SignalTransduction
  • -
Copyright 2019 © ChemicalBook. All rights reserved