ChemicalBook
Chinese english Germany Japanese Korea

Calcitonin (menschlich) Produkt Beschreibung

CALCITONIN, HUMAN Struktur
21215-62-3
CAS-Nr.
21215-62-3
Bezeichnung:
Calcitonin (menschlich)
Englisch Name:
CALCITONIN, HUMAN
Synonyma:
calcitonin M;Unii-I0io929019;Einecs 244-276-2;CALCITONIN, HUMAN;human C carcinoma;hCT Thyrocalcitonin;CALCITONIN M, HUMAN*;THYROCALCITONIN HUMAN;Human calcitonin (1-32);Calcitonin, human synthetic
CBNumber:
CB9184392
Summenformel:
C151H226N40O45S3
Molgewicht:
3417.85
MOL-Datei:
21215-62-3.mol

Calcitonin (menschlich) Eigenschaften

RTECS-Nr.
XP3560000
storage temp. 
−20°C
Aggregatzustand
powder
Merck 
13,1642

Sicherheit

S-Sätze: 22-24/25
WGK Germany  3

Calcitonin (menschlich) Chemische Eigenschaften,Einsatz,Produktion Methoden

S-Sätze Betriebsanweisung:

S22:Staub nicht einatmen.
S24/25:Berührung mit den Augen und der Haut vermeiden.

Verwenden

Regulator (calcium).

Trademarks

Calcimar (Rhone- Poulenc Rorer);.

Calcitonin (menschlich) Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


Calcitonin (menschlich) Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 55)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30002 58
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 sales@jushengtech.com CHINA 28236 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 35440 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Shanghai Macklin Biochemical Co.,Ltd. 15221275939
021-50706099 shenlinxing@macklin.cn China 15719 55
Sigma-Aldrich 021-61415566 800-819-3336(Tel) 400-620-3333(Mobile)
orderCN@merckgroup.com China 34131 80

21215-62-3(Calcitonin (menschlich))Verwandte Suche:


  • Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
  • Calcitonin,huMan,Calcitonin,hu
  • Human calcitonin (1-32)
  • H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2
  • H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
  • CYST-GLY-ASN-LEU-SER-THR-CYST-MET-LEU-GLY-THR-TYR-THR-GLN-AS-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO NH2
  • CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2
  • CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 HUMAN
  • CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7)
  • CALCITONIN, HUMAN
  • THYROCALCITONIN HUMAN
  • calcitonin M
  • CALCITONIN M, HUMAN*
  • calcitonin m, human c carcinoma
  • Calcitonin M, human C carcinoma, Calcitonin, human reduced cyclic (1-7)-disulfide, hCT, Thyrocalcitonin
  • 1,7-Dicarbacalcitonin【human】
  • Calcitonin Human,recombinant
  • Calcitonin, human synthetic
  • Calcitonin, human, for bioassay
  • Einecs 244-276-2
  • Unii-I0io929019
  • Calcitonin, human reduced cyclic(1→7)-disulfide
  • hCT Thyrocalcitonin
  • human C carcinoma
  • 21215-62-3
  • C151H226N40O45S3
  • Cell Signaling and Neuroscience
  • Cell Biology
  • BioChemical
  • Cytokines, Growth Factors and Hormones
  • Hormones
  • Other Protein/Peptide Hormones
  • -
  • Peptide
  • Calcitonin and CGRP receptor
Copyright 2019 © ChemicalBook. All rights reserved