ChemicalBook
Chinese Japanese Germany Korea

SAUVAGINE

SAUVAGINE
SAUVAGINE structure
CAS No.
74434-59-6
Chemical Name:
SAUVAGINE
Synonyms
SAUVAGINE;SAUVAGINE (FROG);M.W. 4599.31 C202H346N56O63S;PYR-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2;H-PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PYR-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;GLP-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2;PGLU-GLY-PRO-PRO-ILE-SER-ILE-ASP-LEU-SER-LEU-GLU-LEU-LEU-ARG-LYS-MET-ILE-GLU-ILE-GLU-LYS-GLN-GLU-LYS-GLU-LYS-GLN-GLN-ALA-ALA-ASN-ASN-ARG-LEU-LEU-LEU-ASP-THR-ILE-NH2
CBNumber:
CB1421369
Molecular Formula:
C202H346N56O63S1
Formula Weight:
4599.31
MOL File:
Mol file

SAUVAGINE Properties

storage temp. 
−20°C
SAFETY
  • Risk and Safety Statements
WGK Germany  3

SAUVAGINE price More Price(2)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich S3884 Sauvagine ≥97% (HPLC) 74434-59-6 250ug $322 2018-11-20 Buy
Sigma-Aldrich S3884 Sauvagine ≥97% (HPLC) 74434-59-6 .5mg $552 2018-11-20 Buy

SAUVAGINE Suppliers

Global( 30)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Wuxi Asia Peptide Biotechnology Limited Company +86 (510) 8358-3050
+86 (510) 8358-3039 willsun@peptide-search.com China 8787 58
Nanjing Leon Biological Technology Co., Ltd. +86 (25) 8452-3390 ex 127
+86 (25) 8452-0790 sales@njleonbiotech.com China 5513 55
Nanjing Peptide Biotech Ltd. 18751911884
025-58361107-806 liugang@njpeptide.com China 9953 55
BOC Sciences 1-631-619-7922
1-631-614-7828 inquiry@bocsci.com United States 10000 58

74434-59-6(SAUVAGINE)Related Search:


Copyright 2017 © ChemicalBook. All rights reserved