ChemicalBook
Chinese Japanese Germany Korea

CRF (HUMAN, RAT)

CRF (HUMAN, RAT)
CRF (HUMAN, RAT) structure
CAS No.
86784-80-7
Chemical Name:
CRF (HUMAN, RAT)
Synonyms
CRH;CRF;crf41;mci028;ratcrf;humancrf;corticobiss;ratcrf(1-41);CRF Acetate;humancrf(1-41)
CBNumber:
CB1777095
Molecular Formula:
C208H344N60O63S2
Formula Weight:
4757.45
MOL File:
Mol file

CRF (HUMAN, RAT) Properties

storage temp. 
−20°C
form 
White to off-white lyophilized solid

SAFETY

WGK Germany  3
RTECS  GM7925000
10

CRF (HUMAN, RAT) price More Price(5)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 .1mg $162 2018-11-13 Buy
Sigma-Aldrich 05-23-0050 Corticotropin Releasing Factor, Human and Rat 86784-80-7 23-0050-1mg $424 2018-11-20 Buy
Alfa Aesar J66835 Corticotropin-Releasing Factor, human, rat 86784-80-7 0.5mg $201 2018-11-13 Buy
Sigma-Aldrich C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 250ug $324 2018-11-13 Buy
Sigma-Aldrich C3042 Corticotropin Releasing Factor human, rat ≥95% (HPLC) 86784-80-7 .5mg $557 2018-11-13 Buy

CRF (HUMAN, RAT) Chemical Properties,Uses,Production

Uses

Treatment of symptoms associated with peritumoral edema in brain tumor patients.

brand name

Xerecept (Hollister-Stier) [Note—The source of the product (human, porcine, etc.) must be indicated in the labeling.].

CRF (HUMAN, RAT) Preparation Products And Raw materials

Raw materials

Preparation Products


CRF (HUMAN, RAT) Suppliers

Global( 78)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
J & K SCIENTIFIC LTD. 400-666-7788 +86-10-82848833
+86-10-82849933 jkinfo@jkchemical.com;market6@jkchemical.com China 96815 76
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15926 69
Arden pharmaceutical &chemical Co., Ltd +86-(0)533-3595900 13793319233
+86-(0)533-3595900 info@chems.com.cn China 670 61
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-54291107 info@hanhonggroup.com China 43389 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32492 50
Shanghai LiuShi Pharmaceutical Technology Co., Ltd. 021-60135539
021-38721356 shlschemical@hotmail.com China 9947 55
Beijing HuaMeiHuLiBiological Chemical 010-56205725;010-86181995
010-65763397 waley188@sohu.com China 12388 58
Haoyuan Chemexpress Co., Ltd. 86-21-58998985
(86) 21-58955996 apisales@chemexpress.com.cn China 7567 61
Shanghai Aladdin Bio-Chem Technology Co.,LTD 021-20337333/400-620-6333
021-50323701 sale@aladdin-e.com China 25106 65

86784-80-7(CRF (HUMAN, RAT))Related Search:


  • Corticotropin Releasing Factor, Human and Rat - CAS 86784-80-7 - Calbiochem
  • corticobiss
  • corticotropin-releasingfactor(horse)
  • corticotropin-releasingfactor(rat)
  • corticotropin-releasingfactor(sheep),2-l-glutamicacid-22-l-alanine-23-l-arg
  • corticotropin-releasinghormone(human)
  • crf41
  • humancorticotropin-releasingfactor
  • humancorticotropin-releasinghormone
  • humancorticotropin-releasinghormone-41
  • humancrf
  • humancrf(1-41)
  • inine-25-l-glutamicacid-38-l-methionine-39-l-glutamicacid-41-l-isoleucinamid
  • mci028
  • ratacth-releasinghormone
  • ratcorticotropin-releasingfactor
  • ratcorticotropin-releasingfactor-41
  • ratcrf
  • ratcrf(1-41)
  • rathypothalamiccrf
  • CRF(human,Rat) Acetate
  • Corticotropin-releasing factor (human) (Human CRF)
  • 86784-80-7
  • BioChemical
  • Amino Acids and Peptides
  • C208H344N60O63S2
  • Ser-Glu-Glu-Pro-Pro-IleSer-Leu-Asp-Leu-Thr-Phe-His-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
  • SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
  • CORTICOTROPIN RELEASING FACTOR
  • CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT
  • CORTICOTROPIN RELEASING FACTOR, HUMAN
  • CORTICOTROPIN RELEASING FACTOR, HUMAN AND RAT
  • CORTICOTROPIN RELEASING FACTOR HUMAN, RAT
  • CRF, HUMAN AND RAT
  • CRF (HUMAN, RAT)
  • CRH
  • CRF
  • H-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2
  • M.W. 4757.45 C208H344N60O63S2
  • Rat/human corticotropin-releasing factor
  • Corticotropin-releasing factor (sheep), 2-L-glutamic acid-22-L-alanine-23-L-arginine- 25-L-glutamic acid-38-L-methionine-39-L-glutamic acid-41-L-isoleucinamide-
  • CRF (huMan, rat) CRF-41, CRH, Corticoliberin, Corticorelin
  • CRF-41, CRH, Corticoliberin, Corticorelin
  • CorticotropinReleasingFactorhuMan,rat,CorticotropinReleasingFactorhuMan
  • H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 acetate salt
  • CRF Acetate
  • CRF(human,rat), CRH
  • Corticotropin-releasing Factor TFA Salt (Human, rat) (Technical Grade)
  • Biochemicals and Reagents
  • Peptide
  • CRF receptor and related
  • Releasing Factors
  • Peptides
  • proteins
Copyright 2017 © ChemicalBook. All rights reserved