ChemicalBook
Chinese Japanese Germany Korea

Calcitonin salmon

Description Sequence Biological Activity Active Substance Application Indication Pharmacodynamics Mechanism of action References
Calcitonin salmon
Calcitonin salmon structure
CAS No.
47931-85-1
Chemical Name:
Calcitonin salmon
Synonyms
tz-ct;SALMON;calcimar;Salcitonin;cibacalcin;Salcatonin;Calcitoran;Salmotonin;Salmon Calcium;Thyrocalcitonin
CBNumber:
CB2127316
Molecular Formula:
C145H240N44O48S2
Formula Weight:
3431.85
MOL File:
47931-85-1.mol

Calcitonin salmon Properties

storage temp. 
−20°C
solubility 
0.05 M acetic acid: 1 mg/mL, clear, colorless
form 
powder
Water Solubility 
Soluble in water at 1mg/ml
Merck 
13,1642
InChIKey
IYTKRMFJECGBRF-LXQLIYPUSA-N
CAS DataBase Reference
47931-85-1(CAS DataBase Reference)

SAFETY

Safety Statements  22-24/25
WGK Germany  3
RTECS  EV8000000
3-10

Calcitonin salmon price More Price(7)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich 05-23-2401 Calcitonin salmon 47931-85-1 23-2401-25mg $509 2018-11-20 Buy
Sigma-Aldrich 1086200 Calcitonin salmon United States Pharmacopeia (USP) Reference Standard 47931-85-1 20mg $3447.15 2018-11-20 Buy
Alfa Aesar J63531 Calcitonin, salmon 47931-85-1 0.5mg $142 2018-11-13 Buy
Sigma-Aldrich C0200000 Calcitonin salmon European Pharmacopoeia (EP) Reference Standard 47931-85-1 2ea $184 2018-11-20 Buy
Sigma-Aldrich T3660 Calcitonin salmon ≥97% (HPLC), powder 47931-85-1 250ug $244 2018-11-13 Buy

Calcitonin salmon Chemical Properties,Uses,Production

Description

Calcitonin Salmon is a polypeptide hormone secreted by the ultimobranchial gland of salmon. It belongs to the calcitonin-like protein family and can be used to treat Paget's disease of bone, postmenopausal osteoporosis(fragile or brittle bones), or high levels of calcium in the blood (hypercalcemia). It appears to have actions essentially identical to calcitonins of mammalian origin, but its potency per mg is greater and it has a longer duration of action. It works mainly by Inhibiting osteoclastic bone resorption, decreasing serum calcium, and increasing renal excretion of phosphate, calcium, sodium magnesium and potassium by decreasing tubular reabsorption.

Sequence

H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 acetate salt (Disulfide bond)

Biological Activity

Hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin also refers as thyrocalcitonin is a 32 amino acid peptide hormone, which is present abundantly in seminal plasma compare to serum. It acts as a first messenger and hence regulate the the production of cAMP as well as mammalian sperm function. It may also facilitate the regulation of different isoforms of adenylyl cyclase. Additionally, salmon calcitonin stimulates the bone formation and inhibits the bone resorption in postmenopausal osteoporotic women.

Active Substance

In humans, salmon calcitonin is more active than its human analog.
Calcitonin (salmon) positively influences bone remodelling and bone mass density due to its inhibiting effect on osteoclast activity. The beneficial effect of salmon calcitonin in the treatment of osteoporotic bone fractures is also due to the promotion of the cartilaginous phase of fracture healing and to pain relief.[www.bachem.com]

Application

1. Calcitonin salmon can be used for calcitonin receptor/cAMP assay for assessing the presence of calcitonin receptors expressed by TRAP+ cells.The product can also be used as a test compound for studying as well as comparing the impact of calcitonin gene related peptide (CGRP) and salmon calcitonin (sCT) on gastric mucosal barrier in rats exposed to cold + restraint stress (CRS). [sigma-aldrich]
2. Calcitonin, Salmon is a calcium regulating hormone secreted from mammalian thyroid parafollicular cells and in non-mammalian species from the ultimobranchial gland. Calcitonins are single chain polypeptides containing 32 amino-acid residues, showing hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. Eel calcitonin (Elcatonin) possesses a similar amino acid to that of the salmon form but is more stable than natural calcitonins because of the absence of disulfide bridges. [Santa Cruz Biotechnology]
3. It shows hypocalcaemic and hypophosphatemic action, with amino-acid structure differing amongst mammalian species. Salmon calcitonin (salcatonin is the synthetic analogue) shows a markedly different sequence to that of the higher vertebrates as well as more potent activity. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. [alfa-aesar]
4. Calcium-regulating peptide hormone released from the thyroid. Lowers calcium concentration in the blood and decreases bone resorption by osteoclasts. Used for therapeutic applications in osteoporosis. Salmon calcitonin peptide sequence differs from mammalian but is more potent.[Enzo Life Sciences, Inc.]

Indication

Calcitonin Salmon Can Used in the treatment of symptomatic Paget's disease for patients unresponsive to alternate treatments or intolerant to such treatments. In addition, it is used in emergency situations when serum calcium levels must be decreased quickly until the underlying condition is identified. It can also be added to existing therapeutic regimens for hypercalcemia such as intravenous fluids and furosemide, oral phosphate or corticosteroids, or other agents. Calcitonin can be used in patients with azotemia and cases where intravenous fluids would be contraindicated due to limited cardiac reserves. Also for the treatment of post-menopausal osteoporosis in women more than 5 years post-menopause.

Pharmacodynamics

Calcitonin inhibits bone resorption by osteoclasts (bone remodeling cells) and promotes bone formation by osteoblasts. This leads to a net increase in bone mass and a reduction in plasma calcium levels. It also promotes the renal excretion of ions such as calcium, phosphate, sodium, magnesium, and potassium by decreasing tubular reabsorption. In consequence, there is an increase in the jejunal secretion of water, sodium, potassium, and chloride.

Mechanism of action

Calcitonin binds to the calcitonin receptor (found primarily in osteoclasts) which then enhances the production of vitamin D producing enzymes (25-hydroxyvitamine D-24-hydroxylase), leading to greater calcium retention and enhanced bone density. Binding of calcitonin to its receptor also activates adenylyl cyclase and the phosphatidyl-inositol-calcium pathway.
References: https://www.drugbank.ca/drugs/DB00017

References

1.http://www.usp.org
2.http://reference.medscape.com
3.https://www.drugs.com/cdi/calcitonin-salmon.html
4.http://www.rxlist.com/miacalcin-side-effects-drug-center.htm
5.http://www.rxlist.com/miacalcin-drug/clinical-pharmacology.htm

Chemical Properties

White or almost white powder.

Uses

Osteoporosis;Hypercalcemia; Paget’s disease ; Reflex sympathetic dystrophy (algodistrophy or Sudeck’s disease)

brand name

Calcimar (Rhone- Poulenc Rorer);.

Calcitonin salmon Preparation Products And Raw materials

Raw materials

Preparation Products


Calcitonin salmon Suppliers

Global( 202)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Henan DaKen Chemical CO.,LTD.
+86-371-55531817
info@dakenchem.com CHINA 21924 58
Henan Tianfu Chemical Co.,Ltd.
0371-55170693
0371-55170693 info@tianfuchem.com CHINA 20680 55
Mainchem Co., Ltd.
+86-0592-6210733
+86-0592-6210733 sales@mainchem.com CHINA 32457 55
Rixing Chemical CO.,LTD
13237129059
- info@rixingchemi.com CHINA 235 55
Nanjing Finetech Chemical Co., Ltd.
025-85710122 17714198479
025-85710122 sales@fine-chemtech.com CHINA 892 55
ATK CHEMICAL COMPANY LIMITED
+86 21 5161 9050/ 5187 7795
+86 21 5161 9052/ 5187 7796 ivan@atkchemical.com CHINA 24196 60
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 20516 58
Chengdu Biopurify Phytochemicals Ltd.
18080483897
maggie@biopurify.com CHINA 2236 58
Chemwill Asia Co.,Ltd.
86-21-51086038
86-21-51861608 chemwill_asia@126.com;sales@chemwill.com;chemwill@hotmail.com;chemwill@gmail.com CHINA 23983 58
Haihang Industry Co.,Ltd
86-531-88032799
+86 531 8582 1093 export@haihangchem.com CHINA 4660 58

View Lastest Price from Calcitonin salmon manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2018-07-24 Calcitonin salmon
47931-85-1
US $20.00 / KG 1KG 98% 50kg career henan chemical co

47931-85-1(Calcitonin salmon)Related Search:


  • Salcitonin
  • Calcitonin Salmon (20 mg) (COLD SHIPMENT REQUIRED)
  • Salcitonin Acetate(SalMon Calcitonin)
  • Salcatonin, SalMon Calcitonin, Thyrocalcitonin (salMon)
  • SalMon Calcitonin Aceta
  • H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-
  • Calcitonin (salMon) xAcetate
  • H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 acetate salt (Disulfide bond)
  • Salcitonin/Calcitonin
  • Calcitonin(Salmone) Acetate
  • Calcitonin salmon Acetate
  • Calcitonin, salmon synthetic
  • salmoncalcitonin-(i-32)
  • CALCITONIN, SALMON
  • CALCITONIN (SALMON I)
  • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
  • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7)
  • CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2
  • CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON
  • H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2
  • H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 (DISULFIDE BRIDGE: 1-7)
  • H-CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2, (DISULFIDE BOND)
  • THYROCALCITONIN SALMON
  • SALMON
  • calcimar
  • cibacalcin
  • salmoncalcitonin
  • Salcatonin for Injection 
  • -
  • Amino Acid Derivatives
  • Peptide
  • Calcitonin and CGRP receptor
  • C145H240N44O48S2
  • salmoncalcitonini
  • tz-ct
  • Salmon Calcitonin Acetate
  • Salcatonin
  • CALCITONIN SALMON 250 UG
  • CalcitoninAcetate
  • Salmon Calcium
  • H-[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2
  • Thyrocalcitonin
  • Salcitonin Acetate
  • M.W. 3431.90 C145H240N44O48S2
  • Calcitoran
  • Salmotonin
  • Calcitonin Acetate,form Salmon
  • 47931-85-1
  • Cell Biology
  • Cell Signaling and Neuroscience
  • BioChemical
  • Cytokines, Growth Factors and Hormones
  • Hormones
  • Other Protein/Peptide Hormones
Copyright 2017 © ChemicalBook. All rights reserved