ChemicalBook >> CAS DataBase List >>GRF (1-44) (HUMAN)

GRF (1-44) (HUMAN)

CAS No.
83930-13-6
Chemical Name:
GRF (1-44) (HUMAN)
Synonyms
HPGRF;SOMATORELIN;GRF (HUMAN);HPGRF, HUMAN;GHRH (HUMAN);GRF Acetate;SOMATOLIBERIN;GHRF (1-44) HUMAN;SERMORELIN (HUMAN);GRF (1-44) (HUMAN)
CBNumber:
CB3311932
Molecular Formula:
C215H358N72O66S
Molecular Weight:
5039.65082
MDL Number:
MFCD00081671
MOL File:
83930-13-6.mol
MSDS File:
SDS
Last updated:2023-05-18 11:31:19

GRF (1-44) (HUMAN) Properties

storage temp. −20°C
form powder
Water Solubility Water : 25 mg/mL (4.96 mM)
EWG's Food Scores 1
FDA UNII 4UR7N9Z9MM
ATC code V04CD05

SAFETY

Risk and Safety Statements

WGK Germany  3

GRF (1-44) (HUMAN) price More Price(11)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Usbiological 154928 Growth Hormone Releasing Hormone 83930-13-6 10ug $320 2021-12-16 Buy
Usbiological 154929 Growth Hormone Releasing Hormone 83930-13-6 10ug $333 2021-12-16 Buy
Usbiological 208929 Growth Hormone Releasing Hormone, Human 83930-13-6 250ug $559 2021-12-16 Buy
ChemScene CS-5901 Humangrowthhormone-releasingfactor 83930-13-6 5mg $924 2021-12-16 Buy
Biorbyt Ltd orb611697 GRF (1-44), human 83930-13-6 5mg $935 2021-12-16 Buy
Product number Packaging Price Buy
154928 10ug $320 Buy
154929 10ug $333 Buy
208929 250ug $559 Buy
CS-5901 5mg $924 Buy
orb611697 5mg $935 Buy

GRF (1-44) (HUMAN) Chemical Properties,Uses,Production

Structure

GHRH(1–29) is the bioactive core of human GHRH. The N-terminal tyrosine residue with selected aromatic rings is important for the high bioactivity in human and nonrodent mammalian GHRH. The amino acid sequence of GHRH shows higher identities between the human, porcine, bovine, and caprine species, but the rat and mouse are exceptions. The sequence of the C-terminus is highly variable among species while the N-terminus is more conserved. The N-terminal region (1–27) of GHRH is well conserved in nonmammalian vertebrates. Zebrafish GHRH (1–27) shows 74.1%, 81.5%, and 81.5% similarity to the Xenopus tropicalis, chicken, and human counterparts, respectively. Mr 12,447 (GHRH(1-44), Mr 5,039), pI 10.3 (GHRH(1- 44), pI 11.5). Soluble in acidic aqueous solution (e.g., 1% acetic acid). Lyophilized GHRH is stable at room temperature for 2months, and recommended storage is below -18°C with desiccation.

Gene, mRNA, and precursor

The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.

Synthesis and release

The human GHRH gene, GHRH, location 20q11.2, consists of five exons. GHRH mRNA has 459 bases that encode a signal peptide of 24 aa residues, a mature protein of 44 aa residues, and a C-peptide of 31 aa residues with unknown function. In nonmammalian vertebrates, the GHRH-like peptide and PACAP were first believed to be encoded by the same gene, but later actual GHRH and PACAP were found to be encoded by two distinct genes.

Synthesis and release

The synthesis and release of GHRH are regulated by sex hormones, aging, the negative feedback effect of GH, and diverse pathological conditions. Gsh-1 has been considered a transcriptional factor of Ghrh expression in the rat hypothalamus. GHRH synthesis is inhibited by somatostatin (SS). The expression levels of the SS receptor, sst2A, in GHRH neurons are higher in female mice than male mice. The production of hypothalamic GHRH is decreased by aging. It is also negatively regulated by the feedback of GH, whereas ghrelin stimulates GHRH release.

Receptors

GHRH-R belongs to the GPCR B II subclass, highly selective for GHRH. The GHRH-R of most mammals consists of 423 aa residues. The N-terminal extracellular domain contains a site for N-glycosylation as well as six cysteine residues and an aspartate residue that are conserved in this receptor family. The third intracellular loop and the C-terminal intracellular domain contain several potential phosphorylation sites, which may regulate signaling and receptor internalization. It is mainly expressed in the pituitary.

Agonists and Antagonists

Tesamorelin, sermorelin (GHRH(1–29)-NH2), and CJC-1295 are agonists. Antagonists comprise the antibodies or peptides to GHRH-R: JV-1-10, JV-1-36, JV-1-37, JV-1-38, JV-1-39, JV-1-40, JV-1-41, JV-1-42, JV-1-43, JV-1-62, JV-1-63, MZ-4-71, MZ-4-169, MZ-4-181, MZ-4-243, MZ-5-78, MZ-5-156, MZ-5-192, MZ-6-55, [Ac-Tyr1, D-Arg2] GHRH(1–29)-NH2.

Biological functions

GHRH receptor mRNA is expressed in several organs, especially in the adrenal, digestive tract, and kidney. The primary function of GHRH is to stimulate GH synthesis and release from the anterior pituitary somatotrophs. GHRH activates cell proliferation, cell differentiation, and growth of somatotrophs, and is also involved in the modulation of appetite and feeding behavior, the regulation of sleeping, the control of jejunal motility, and the increase in leptin levels in modest obesity .

Clinical implications

Mutations in the GHRH gene have never been described. A single base change in the GHRH-R gene in human somatotropinoma confers hypersensitivity to GHRH binding. Pit-1 mutation inducing the low gene expression of GHRH-R can lead to the development of dwarfism.

Description

GHRH is expressed and secreted from the hypothalamic neurons of the arcuate nucleus (ARC). GHRH stimulates the release of growth hormone (GH) in the anterior pituitary. In 1982, three isoforms of GHRH(1–37, 1–40, 1–44 aa residues) were initially isolated from human pancreatic tumors that caused acromegaly, and the latter two were found in the human hypothalamus. The aa sequence of GHRH was also identified in various vertebrates from rodents to fish, including a protochordate. In nonmammalian vertebrates, GHRH-like peptide (pituitary adenylate cyclase-activating polypeptide (PACAP)-related peptide in mammals) was first isolated like GHRH, although the GHRH-like peptide had less activity on GH release. Later, actual GHRH, which was more phylogenetically and structurally similar to mammalian GHRH and showed GH-releasing activity, was isolated in nonmammalian vertebrates.

Clinical Use

Sermorelin, a functional peptide fragment of GHRH (1–29), has been used in the diagnosis and treatment of children with idiopathic growth hormone deficiency. Tesamorelin, a stabilized synthetic peptide analog of GHRH(1–44), received US Food and Drug Administration approval in 2010 for the treatment of lipodystrophy in HIV patients under highly active antiretroviral therapy, and was investigated for effects on certain cognitive functions in adults with cognitive impairment as well as healthy older adults.

GRF (1-44) (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

GRF (1-44) (HUMAN) Suppliers

Global( 110)Suppliers
Supplier Tel Email Country ProdList Advantage
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
Alpha Biopharmaceuticals Co., Ltd
+86-411-39042497 +8613921981412 sales@alphabiopharm.com China 886 58
Henan Tianfu Chemical Co.,Ltd.
+86-0371-55170693 +86-19937530512 info@tianfuchem.com China 21691 55
career henan chemical co
+86-0371-86658258 sales@coreychem.com China 29914 58
.GZ HONESTCHEM CO.,LTD
+86-15013270415 honestchemical@foxmail.com China 247 58
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10248 58
Hubei xin bonus chemical co. LTD
86-13657291602 linda@hubeijusheng.com CHINA 22968 58
Chongqing Chemdad Co., Ltd
+86-023-61398051 +8613650506873 sales@chemdad.com China 39916 58
SIMAGCHEM CORP
+86-13806087780 sale@simagchem.com China 17367 58
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
+8618068519287 sales@xuanmingchem.com China 822 58

View Lastest Price from GRF (1-44) (HUMAN) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
Somatorelin GRF(human)Acetate pictures 2022-02-18 Somatorelin GRF(human)Acetate
83930-13-6
US $0.00 / gram 1gram 99% 10kg Zhejiang J&C Biological Technology Co.,Limited
GRF (human) pictures 2021-07-13 GRF (human)
83930-13-6
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd
GRF (human) pictures 2021-07-09 GRF (human)
83930-13-6
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd
  • GRF (human) pictures
  • GRF (human)
    83930-13-6
  • US $15.00-10.00 / KG
  • 99%+ HPLC
  • Zhuozhou Wenxi import and Export Co., Ltd
  • GRF (human) pictures
  • GRF (human)
    83930-13-6
  • US $15.00-10.00 / KG
  • 99%+ HPLC
  • Zhuozhou Wenxi import and Export Co., Ltd
SERMORELIN (HUMAN) SOMATOCRININ (HUMAN) SOMATOLIBERIN (HUMAN) SOMATORELIN YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2 GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin Growth HorMone Releasing Factor huManGrowth HorMone Releasing Fa H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 acetate salt YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2 H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH HPGRF HPGRF, HUMAN GROWTH HORMONE-RELEASING HORMONE (HUMAN) GROWTH HORMONE RELEASING FACTOR (1-44), HUMAN GROWTH HORMONE RELEASING FACTOR, HUMAN GROWTH HORMONE RELEASING FACTOR (1-44), AMIDE, HUMAN GRF (1-44), AMIDE, HUMAN GRF (1-44) (HUMAN) GRF (HUMAN) GHFR (1-44), HUMAN GHRH (1-44), HUMAN GHRH (HUMAN) GHRF (1-44) HUMAN Human growth hormone-releasing factor GRF (human)|GHRF (1-44), human GRF Acetate GRF(human) Acetate H-Tyr-Ala-Asp-Ala-Lle-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-lys-Leu-Leu-Gln-Asp-Lle-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 SOMATOLIBERIN M.W. 5039.72 C215H358N72O66S Human growth hormone-releasing hormone (1-44) amide Somatorelin Acetate Growth-hormone-releasing hormone Growth hormone releasing factor, human, ≥95% (HPLC) GRF (1-44) (HUMAN) USP/EP/BP Somatorelin GRF(human)Acetate GRF (human) Acetate 83930-13-6 Somatorelin/GRF (1-44) (human) GHRF (1-44), human GRF 83930-13-6 C215H358N72O66S Amino Acids and Peptides BioChemical GH-RH Releasing Factors Peptides Biochemicals and Reagents Peptide VIP and PACAP receptor peptides pharm