ChemicalBook
Chinese Japanese Germany Korea

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2
H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 structure
CAS No.
215510-06-8
Chemical Name:
H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2
Synonyms
PRRP31 (RAT);PREPROLACTIN (23-53) (RAT);PROLACTIN-RELEASING PEPTIDE (RAT);SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2;PROLACTIN RELEASING PEPTIDE (1-31), RAT;PrRP31 (rat), Preprolactin (23-53) (rat);SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2;H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2
CBNumber:
CB6282255
Molecular Formula:
C28H24N4O5
Formula Weight:
496.51396
MOL File:
215510-06-8.mol

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 Properties

storage temp. 
−20°C
SAFETY
  • Risk and Safety Statements
WGK Germany  3

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 price More Price(1)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Alfa Aesar J66395 Prolactin Releasing Peptide (1-31), rat 215510-06-8 1mg $257 2018-11-13 Buy

H-SER-ARG-ALA-HIS-GLN-HIS-SER-MET-GLU-THR-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-THR-GLY-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2 Suppliers

Global( 15)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50
Cellmano Biotech Limited +86-551-65326643
+86-551-65326641 info@cellmano.com China 998 55
Watson International Ltd. 86-0512-81863996; +44 (0)20 360 89 360-31
86-512-81867260/70/80-3; +44 (0)20 360 89 360-31-9 contact@watson-int.com China 14916 58
Wuxi Asia Peptide Biotechnology Limited Company +86 (510) 8358-3050
+86 (510) 8358-3039 willsun@peptide-search.com China 8793 58
Nanjing Leon Biological Technology Co., Ltd. +86 (25) 8452-3390 ex 127
+86 (25) 8452-0790 sales@njleonbiotech.com China 5513 55
Nanjing Peptide Biotech Ltd. 18751911884
025-58361107-806 liugang@njpeptide.com China 9952 55
Nanjing Meihao Pharmaceutical Technology Co., Ltd. meitaochem@126.com
meitaochem@126.com China 19112 58

Copyright 2017 © ChemicalBook. All rights reserved