ChemicalBook
Chinese Japanese Germany Korea

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 structure
CAS No.
127317-03-7
Chemical Name:
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
Synonyms
M-PACAP;PACAP-27;PACAP 1-27;PACAP (1-27) AMIDE;PACAP 27 AMIDE, OVINE;powdered posterior pitultary;PACAP-27 (HUMAN, OVINE, RAT);HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2;PACAP (1-27), HUMAN, OVINE, RAT;PACAP (1-27) (HUMAN, SHEEP, RAT)
CBNumber:
CB7101106
Molecular Formula:
C142H224N40O39S
Formula Weight:
3147.61
MOL File:
127317-03-7.mol

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Properties

Density 
1.45±0.1 g/cm3(Predicted)
storage temp. 
−20°C
form 
solid
color 
white
SAFETY
  • Risk and Safety Statements
WGK Germany  3

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich A9808 Pituitary adenylate cyclase activating polypeptide-27 ovine ≥97% (HPLC), solid 127317-03-7 0 $0 2019-12-02 Buy
Sigma-Aldrich 05-23-2151 PACAP 27 Amide, Ovine Increases cAMP levels in a dose-dependent manner (EC = 4.7 nM). 127317-03-7 23-2151-0.5mg $302 2019-12-02 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 1mg $339 2019-12-02 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 0.5mg $210 2019-12-02 Buy

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Chemical Properties,Uses,Production

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Preparation Products And Raw materials

Raw materials

Preparation Products


H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Suppliers

Global( 55)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 linda@hubeijusheng.com CHINA 28235 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Beijing Yibai Biotechnology Co., Ltd
0086-182-6772-3597
sales03@yibaibiotech.com CHINA 420 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
career henan chemical co
0086-371-86658258
0086-371-86658258 factory@coreychem.com CHINA 29608 58
Zhuozhou Wenxi import and Export Co., Ltd
+8613111626072
+8613111626072 zzwenxi@126.com CHINA 7496 58
Neostar United (Changzhou) Industrial Co., Ltd.
+0086-519-85557386
+0086-519-85557389 marketing1@neostarunited.com CHINA 4111 58
3B Pharmachem (Wuhan) International Co.,Ltd. 18930552037 821-50328103-801
86-21-50328109 3bsc@sina.com China 15881 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202-
+86-21-64545202 info@hanhonggroup.com;info@hanhonggroup.com China 43258 64

View Lastest Price from H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2020-02-13 H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
127317-03-7
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co

127317-03-7(H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2)Related Search:


Copyright 2017 © ChemicalBook. All rights reserved