ChemicalBook
Chinese Japanese Germany Korea

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 structure
CAS No.
127317-03-7
Chemical Name:
H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2
Synonyms
M-PACAP;PACAP-27;PACAP 1-27;PACAP (1-27) AMIDE;PACAP 27 AMIDE, OVINE;powdered posterior pitultary;PACAP-27 (HUMAN, OVINE, RAT);HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2;PACAP (1-27), HUMAN, OVINE, RAT;PACAP (1-27) (HUMAN, SHEEP, RAT)
CBNumber:
CB7101106
Molecular Formula:
C142H224N40O39S
Formula Weight:
3147.61
MOL File:
127317-03-7.mol

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Properties

Density 
1.45±0.1 g/cm3(Predicted)
storage temp. 
−20°C
form 
solid
color 
white
SAFETY
  • Risk and Safety Statements
WGK Germany  3

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 price More Price(5)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich A9808 Pituitary adenylate cyclase activating polypeptide-27 ovine ≥97% (HPLC), solid 127317-03-7 0 $0 2019-12-02 Buy
Sigma-Aldrich 05-23-2151 PACAP 27 Amide, Ovine Increases cAMP levels in a dose-dependent manner (EC = 4.7 nM). 127317-03-7 23-2151-0.5mg $314 2020-08-18 Buy
Sigma-Aldrich 05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Increases cAMP levels in a dose-dependent manner (EC?? = 4.7 nM). 127317-03-7 .5 mg $326 2021-03-22 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 1mg $387 2021-03-22 Buy
Alfa Aesar J66752 PACAP (1-27), human, ovine, rat 127317-03-7 0.5mg $200 2020-06-24 Buy

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Chemical Properties,Uses,Production

H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Preparation Products And Raw materials

Raw materials

Preparation Products


H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 Suppliers

Global( 80)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Hubei Jusheng Technology Co.,Ltd.
86-18871470254
027-59599243 linda@hubeijusheng.com CHINA 28229 58
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4000 58
BOC Sciences
1-631-485-4226
1-631-614-7828 inquiry@bocsci.com United States 19752 58
Beijing Yibai Biotechnology Co., Ltd
0086-182-6772-3597
sales04@yibaibiotech.com CHINA 420 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 37282 58
Cellmano Biotech Limited
18156095617 0551-65326643
0551-65326641 info@cellmano.com CHINA 1039 58
career henan chemical co
13203830695 0086-371-86658258
0086-371-86658258 factory@coreychem.com CHINA 29864 58
Zhuozhou Wenxi import and Export Co., Ltd
+8613111626072 (WhatsApp)
Wechat: +8613111626072 Wickr me: waynehu zzwenxi@126.com CHINA 13187 58
Neostar United (Changzhou) Industrial Co., Ltd.
+0086-519-85557386
+0086-519-85557389 marketing1@neostarunited.com CHINA 4135 58
Target Molecule Corp
18019718960 781-999-5354
marketing@targetmol.com United States 19232 58

View Lastest Price from H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2 manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2021-07-13 127317-03-7
127317-03-7
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd
2021-07-10 127317-03-7
127317-03-7
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd
2021-07-02 127317-03-7
127317-03-7
US $15.00-10.00 / KG 1KG 99%+ HPLC Monthly supply of 1 ton Zhuozhou Wenxi import and Export Co., Ltd

127317-03-7(H-HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-NH2)Related Search:


Copyright 2017 © ChemicalBook. All rights reserved