ChemicalBook
Chinese Japanese Germany Korea

Nesiritide acetate

Nesiritide acetate
Nesiritide acetate structure
CAS No.
114471-18-0
Chemical Name:
Nesiritide acetate
Synonyms
BNP-32;Fam-BNP;Nesirtide;BNP HUMAN;BNP-32 (HUMAN);BNP (1-32), HUMAN;NESIRITIDE ACETATE;natriureticpeptide,brain;BRAIN NATRIURETIC PEPTIDE;Natriuretic factor, brain
CBNumber:
CB8676346
Molecular Formula:
C143H244N50O42S4
Formula Weight:
3464.04
MOL File:
114471-18-0.mol

Nesiritide acetate Properties

storage temp. 
−20°C
form 
powder
CAS DataBase Reference
114471-18-0(CAS DataBase Reference)

SAFETY

WGK Germany  3

Nesiritide acetate price

Manufacturer Product number Product description CAS number Packaging Price Updated Buy

Nesiritide acetate Chemical Properties,Uses,Production

Uses

hemostatic, antimicrobial

Nesiritide acetate Preparation Products And Raw materials

Raw materials

Preparation Products


Nesiritide acetate Suppliers

Global( 123)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Shenzhen Sendi Biotechnology Co.Ltd.
0755-23311925 18102838259
0755-23311925 Abel@chembj.com CHINA 3203 55
Henan DaKen Chemical CO.,LTD.
+86-371-55531817
info@dakenchem.com CHINA 21930 58
Henan Tianfu Chemical Co.,Ltd.
0371-55170693
0371-55170693 info@tianfuchem.com CHINA 20680 55
Mainchem Co., Ltd.
+86-0592-6210733
+86-0592-6210733 sales@mainchem.com CHINA 32457 55
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 20516 58
Chengdu Biopurify Phytochemicals Ltd.
18080483897
maggie@biopurify.com CHINA 2236 58
Chemwill Asia Co.,Ltd.
86-21-51086038
86-21-51861608 chemwill_asia@126.com;sales@chemwill.com;chemwill@hotmail.com;chemwill@gmail.com CHINA 23982 58
Hubei Jusheng Technology Co.,Ltd.
86-188-71490254
peter@hubeijusheng.com CHINA 20094 58
Arden pharmaceutical &chemical Co., Ltd +86-(0)533-3595900 13793319233
+86-(0)533-3595900 info@chems.com.cn China 670 61
Alabiochem Tech.Co., Ltd. 0086-512-58900862; 400-0707-518; 0086-512-56727736
0086-512-56765862 sales@alabiochem.com China 944 59

View Lastest Price from Nesiritide acetate manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2018-07-24 Nesiritide acetate
114471-18-0
US $10.00 / G 1KG 99% 20kg career henan chemical co

114471-18-0(Nesiritide acetate)Related Search:


  • BNP-32
  • BNP-32 (HUMAN)
  • BNP (1-32), HUMAN
  • H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH
  • H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26)
  • NESIRITIDE ACETATE
  • SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS
  • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26)
  • Nesiritide Acetate (BNP-32)
  • BRAIN NATRIURETIC PEPTIDE, PORCINE SYNTH ETIC >97%
  • BRAIN NATRIURETIC PEPTIDE
  • atrial natriuretic peptide, 1-32, human
  • Brain natriuretic factor【human】
  • Brain natriuretic factor-32【human】
  • Human brain natriuretic peptide-32
  • Nesiritide Acetate (BNP-32) Brain Natriuretic Pept
  • natriureticpeptide,brain
  • BRAIN NATRIURETIC PEPTIDE, HUMAN
  • BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN
  • Natriuretic factor, brain
  • Nesirtide
  • -
  • 114471-18-0
  • C143H244N50O42S4
  • Amino Acids and Peptides
  • Biochemicals and Reagents
  • BioChemical
  • Natriuretic Peptides
  • Peptides
  • Amino Acid Derivatives
  • Peptide
  • SignalTransduction
  • Fam-BNP
  • brain natriuretic peptide-32
  • BRAIN NATRIURETIC PEPTIDE-32 (HUMAN)
  • BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN)
  • B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN)
  • BNP HUMAN
Copyright 2017 © ChemicalBook. All rights reserved