ChemicalBook >> CAS DataBase List >>Sermorelin

Sermorelin

Sermorelin structure

CAS No.: 86168-78-7

Chemical Name:: Sermorelin

Synonyms: Semorelin;SERMORELIN;Sermorelin Aceta;Sermelin Acetate;Sermorelin USP/EP/BP;86168-78-7 Sermorelin;Sermorelin Acetate(net);GRF (1-29) AMIDE (HUMAN);GHRF (1-29), AMIDE, HUMAN;Green tea powdered extract

CBNumber:: CB9474927

Molecular Formula:: C149H246N44O42S

Molecular Weight:: 3357.93

MDL Number:: MFCD00076559

MOL File:: 86168-78-7.mol

Last updated:2024-03-29 13:39:17

Request For Quotation

Sermorelin Properties

Melting point	>189°C (dec.)
alpha	D20 -63.1° (c = 1 in 30% acetic acid)
Density	1.45±0.1 g/cm3(Predicted)
storage temp.	−20°C
solubility	Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
form	Solid
color	White to Off-White
Stability	Hygroscopic
InChIKey	BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference	86168-78-7(CAS DataBase Reference)
FDA UNII	89243S03TE
Proposition 65 List	Sermorelin Acetate
ATC code	H01AC04,V04CD03

SAFETY

Risk and Safety Statements

WGK Germany	3

Sermorelin price More Price(6)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich	G6771	Growth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC)	86168-78-7	1mg	$295.2	2024-03-01	Buy
Alfa Aesar	J61111	Growth Hormone Releasing Factor (GRF) (1-29) amide, human	86168-78-7	0.5mg	$144	2023-06-20	Buy
Alfa Aesar	J61111	Growth Hormone Releasing Factor (GRF) (1-29) amide, human	86168-78-7	1mg	$204	2021-12-16	Buy
American Custom Chemicals Corporation	SHG0000180	SERMORELIN 95.00%	86168-78-7	0.5MG	$600.6	2021-12-16	Buy
DC Chemicals	DC10321	Sermorelin >98%	86168-78-7	250mg	$1100	2021-12-16	Buy

Product number	Packaging	Price	Buy
G6771	1mg	$295.2	Buy
J61111	0.5mg	$144	Buy
J61111	1mg	$204	Buy
SHG0000180	0.5MG	$600.6	Buy
DC10321	250mg	$1100	Buy

Sermorelin Chemical Properties,Uses,Production

Description

Sermorelin is licensed as a diagnostic test for secretion of growth hormone. It is also used for the treatment of growth hormone deficiency in children. However, products containing sermorelin were withdrawn from the United States market by the manufacturer in November 2002.

Uses

Sermorelin is a xanthine oxidase inhibitor and a peptide hormone that stimulates release of the growth hormon. Sermorelin Acetate, was used for characterization of a growth hormone-releasing factor from a human pancreatic islet tumor. It is also used to diagnose and treat poor growth in children. It is sometimes used off-label to treat hGH deficiency in adults.

benefits

The benefits of sermorelin include: Improved body composition, muscle function, and strength; Faster and efficient healing of wounds; Reduced body fat, especially abdominal fat; Enhanced immune system, bone health, and cardiovascular function; Improved sleep quality, mood, and mental clarity.

Side effects

The most common side effect of sermorelin is caused by its injection under your skin. You may experience any of the following at the site of injection:
irritation
itching
sensitivity
swelling
pain
redness

Drug interactions

Sermorelin may interact with other medications. Drug interactions that may interfere with sermorelin include:
thyroid medications (levothyroxine)
cyclooxygenase inhibitors (aspirin)
glucocorticoids (prednisone)
insulin
muscarinic antagonists (atropine)
somatostatin-containing drugs or drugs that affect somatostatin (levodopa)

Sermorelin Preparation Products And Raw materials

Raw materials

Preparation Products

Sermorelin Suppliers

Global( 253)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
Wuhan Cell Pharmaceutical Co., Ltd	+86-13129979210 +86-13129979210	sales@cellwh.com	China	376	58
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	999	58
Zhuzhou New Peptides Tech Co.,Ltd.	+8618073326374	sales@goodpeptides.com	China	140	58
Hebei Anlijie Biotechnology Co., Ltd	+8619031013551	ably@aljbio.com	China	177	58
Nantong Guangyuan Chemicl Co,Ltd	+undefined17712220823	admin@guyunchem.com	China	616	58
Henan Tengmao Chemical Technology Co. LTD	+8615238638457	salesvip2@hntmhg.com	China	415	58
Hebei Xunou new energy Technology Co., LTD	+undefined17531957005	xunou8@hbxunou.com	China	36	58
Zhejiang Hangyu API Co., Ltd	+8617531972939	anna@api-made.com	China	2944	58
Shanghai Getian Industrial Co., LTD	+undefined15373193816	mike@ge-tian.com	China	272	58
Hebei Mojin Biotechnology Co., Ltd	+8613288715578	sales@hbmojin.com	China	12453	58

Supplier	Advantage
Wuhan Cell Pharmaceutical Co., Ltd	58
Cellmano Biotech Limited	58
Zhuzhou New Peptides Tech Co.,Ltd.	58
Hebei Anlijie Biotechnology Co., Ltd	58
Nantong Guangyuan Chemicl Co,Ltd	58
Henan Tengmao Chemical Technology Co. LTD	58
Hebei Xunou new energy Technology Co., LTD	58
Zhejiang Hangyu API Co., Ltd	58
Shanghai Getian Industrial Co., LTD	58
Hebei Mojin Biotechnology Co., Ltd	58

View Lastest Price from Sermorelin manufacturers

Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
2024-04-19	Sermorelin 86168-78-7	US $10.00 / mg	1mg	98%	20ton	Hebei Kangcang new material Technology Co., LTD
2024-04-19	Sermorelin 86168-78-7	US $9.90-9.90 / mg	1mg	99%	1000g	Wuhan Cell Pharmaceutical Co., Ltd
2024-04-19	Sermorelin 86168-78-7	US $660.00-650.00 / Gram	1Gram	99.99%	100Tons	Hebei Dangtong Import and export Co LTD

Sermorelin
86168-78-7
US $10.00 / mg
98%
Hebei Kangcang new material Technology Co., LTD

Sermorelin
86168-78-7
US $9.90-9.90 / mg
99%
Wuhan Cell Pharmaceutical Co., Ltd

Sermorelin
86168-78-7
US $660.00-650.00 / Gram
99.99%
Hebei Dangtong Import and export Co LTD

86168-78-7(Sermorelin)Related Search:

Taltirelin Degarelix BUSERELIN Elcatonin Calcitonin salmon

Nesiritide acetate Thymopentin Triptorelin acetate Pramlintide acetate GLP-1 (7-37)

Eptifibatide Thymalfasin Leuprorelin GROWTH HORMONE, HUMAN SERMORELIN (HUMAN)

Sermorelin Sermorelin acetate SERMORELIN (HUMAN)

1of4

SERMORELIN YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN growth hormone releasing factor*fragment 1-29 ami H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN GRF (1-29) AMIDE (HUMAN) GROWTH HORMONE RELEASING FACTOR, FRAGMENT 1-29 AMIDE GROWTH HORMONE RELEASING FACTOR FRAGMENT 1-29 AMIDE HUMAN GHRF (1-29), AMIDE, HUMAN Green tea powdered extract SERMORELIN, GROWTH HORMONE RELEASING FACTOR FRAGMENT 1-29 AMIDE somatoliberin fragment 1-29 amide, human Sermorelin Aceta TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-GLY-ALA-LYS-VAL-ARG-LEU-NH2: YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 [D-Ala2]-Growth Hormone Releasing Factor, GRF (1-29), amide, human GRF (1-29) aMide (huMan) SerMorelin Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Thr-Arg-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH{2} 1-29-SOMATOLIBERIN (HUMAN PANCREATIC ISLET), 29-L-ARGININAMIDE- Sermelin Acetate Sermorelin,GHRH (1-29),Growth Hormone Releasing Factor Fragment 1-29 amide human, BR Peptides Sermorelin Base Sermorelin Acetate Sermorelin USP/EP/BP 86168-78-7 Sermorelin Sermorelin Acetate(net) Semorelin Sermorelin (GRF (1-29) amide) Sermorelin，GHRH (1-29)，Growth Hormone Releasing Factor Fragment 1-29 amide human 86168-78-7 C149H246N44O42S Releasing Factors Peptides GH-RH Biochemicals and Reagents Amino Acids and Peptides BioChemical Peptide Amino Acid Derivatives GH-RHObesity Research GH-RHPeptides for Cell Biology Growth Hormone Releasing Factors Neuropeptides Neurotransmission (Obesity) Releasing Factors Sermorelin 86168-78-7