ChemicalBook >> CAS DataBase List >>Sermorelin

Sermorelin

Sermorelin structure

CAS No.: 86168-78-7

Chemical Name:: Sermorelin

Synonyms: Semorelin;SERMORELIN;Sermorellin;Sermorelin Aceta;Sermelin Acetate;Semonelin Acetale;Sermorelin USP/EP/BP;86168-78-7 Sermorelin;Sermorelin Acetate(net);Sermorelin (GHRH (1-29)

CBNumber:: CB9474927

Molecular Formula:: C149H246N44O42S

Molecular Weight:: 3357.93

MDL Number:: MFCD00076559

MOL File:: 86168-78-7.mol

Last updated:2025-10-13 08:54:47

Product description	Number	Pack Size	Price
Growth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC)	G6771	1mg	$701.48
SERMORELIN 95.00%	SHG0000180	0.5MG	$600.6
Sermorelin >98%	DC10321	250mg	$1100
More product size

Request For Quotation

Sermorelin Properties

Melting point	>189°C (dec.)
alpha	D20 -63.1° (c = 1 in 30% acetic acid)
Density	1.45±0.1 g/cm3(Predicted)
storage temp.	−20°C
solubility	Acetic Acid (Slightly), Trifluoroacetic Acid (Slightly), Water (Slightly)
form	Solid
color	White to Off-White
Stability	Hygroscopic
InChIKey	BVLCEKWPOSAKSZ-YQMCHIOTSA-N
CAS DataBase Reference	86168-78-7(CAS DataBase Reference)
FDA UNII	89243S03TE
Proposition 65 List	Sermorelin Acetate
ATC code	H01AC04,V04CD03

SAFETY

Risk and Safety Statements

WGK Germany	3

Sermorelin price More Price(7)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich	G6771	Growth Hormone Releasing Factor Fragment 1-29 amide human ≥97% (HPLC)	86168-78-7	1mg	$701.48	2025-07-31	Buy
American Custom Chemicals Corporation	SHG0000180	SERMORELIN 95.00%	86168-78-7	0.5MG	$600.6	2021-12-16	Buy
DC Chemicals	DC10321	Sermorelin >98%	86168-78-7	250mg	$1100	2021-12-16	Buy

Product number	Packaging	Price	Buy
G6771	1mg	$701.48	Buy
SHG0000180	0.5MG	$600.6	Buy
DC10321	250mg	$1100	Buy

Sermorelin Chemical Properties,Uses,Production

Description

Sermorelin is licensed as a diagnostic test for secretion of growth hormone. It is also used for the treatment of growth hormone deficiency in children. However, products containing sermorelin were withdrawn from the United States market by the manufacturer in November 2002.

Uses

Sermorelin is a xanthine oxidase inhibitor and a peptide hormone that stimulates release of the growth hormon. Sermorelin Acetate, was used for characterization of a growth hormone-releasing factor from a human pancreatic islet tumor. It is also used to diagnose and treat poor growth in children. It is sometimes used off-label to treat hGH deficiency in adults.

Definition

Sermorelin is an analogue of growth hormone-releasing hormone (GHRH) primarily used for diagnostic purposes. It is a 29-amino acid-containing fragment of endogenous human GHRH, also represented as GHRH (1–29). Sermorelin is the shortest fully functional synthetic fragment of GHRH. It was marketed under the trade name of Geref by Serono Laboratories, but the FDA recently listed it as a “discontinued drug product.”

brand name

Geref,Gerel

benefits

The benefits of sermorelin include: Improved body composition, muscle function, and strength; Faster and efficient healing of wounds; Reduced body fat, especially abdominal fat; Enhanced immune system, bone health, and cardiovascular function; Improved sleep quality, mood, and mental clarity.

Mechanism of action

Sermorelin binds to the growth hormone-releasing hormone receptor (GHRH), mimicking the effects of the full-length GHRH in promoting growth hormone secretion.

Side effects

The most common side effect of sermorelin is caused by its injection under your skin. You may experience any of the following at the site of injection:
irritation
itching
sensitivity
swelling
pain
redness

Drug interactions

Sermorelin may interact with other medications. Drug interactions that may interfere with sermorelin include:
thyroid medications (levothyroxine)
cyclooxygenase inhibitors (aspirin)
glucocorticoids (prednisone)
insulin
muscarinic antagonists (atropine)
somatostatin-containing drugs or drugs that affect somatostatin (levodopa)

Sermorelin Preparation Products And Raw materials

Raw materials

Preparation Products

Sermorelin Suppliers

Global( 272)Suppliers

Supplier	Tel	Email	Country	ProdList	Advantage
TsurgeX Pharmaceutical Technology Co., Ltd.	+8613393959797	master@tsurgex.com	China	44	58
Cellmano Biotech Limited	0551-65326643 18156095617	info@cellmano.com	China	995	58
Anko Intermational Trade Limited	+86-18073326374	sales@goodpeptides.com	China	59	58
Hangzhou Hyper Chemicals Limited	+86-0086-57187702781 +8613675893055	info@hyper-chem.com	China	295	58
Shanghai Longyu Biotechnology Co., Ltd.	+8619521488211	info@longyupharma.com	China	2557	58
American HealthyMorph LLC	+85269498027	nancyyuan133@163.com	China	169	58
Forest chemical technology	+85295407470	grant@forestchem.freeqiye.com	China	754	58
Chongqing Soarwin Technology Co., Ltd	+86-15790943001	crystal@sorawin.cn	China	421	58
Anhui Yiao New Material Technology Co., Ltd	+86-18033737140 +86-17354101231	sales1@hbganmiao.com	China	227	58
Henan Bao Enluo International TradeCo.，LTD	+86-17331933971	deasea125996@gmail.com	China	2472	58

Supplier	Advantage
TsurgeX Pharmaceutical Technology Co., Ltd.	58
Cellmano Biotech Limited	58
Anko Intermational Trade Limited	58
Hangzhou Hyper Chemicals Limited	58
Shanghai Longyu Biotechnology Co., Ltd.	58
American HealthyMorph LLC	58
Forest chemical technology	58
Chongqing Soarwin Technology Co., Ltd	58
Anhui Yiao New Material Technology Co., Ltd	58
Henan Bao Enluo International TradeCo.，LTD	58

Sermorelin: Beyond Growth Hormone Stimulation
Sermorelin, a GHRH analog, stimulates endogenous growth hormone secretion. It's used in growth hormone deficiency and explored....
Oct 13，2025

Related Qustion

Ask a question

Q:What is the benefits and side effects of Sermorelin??Zora? - Sep 9，2025

A:Sermorelin is a peptide similar in structure to growth hormone-releasing hormone (GHRH). It stimulates the pituitary to release adequate amounts of growth hormone in concert with the body's circadian rhythm, has been used in the diagnosis and treatment of children with idiopathic growth hormone deficiency. Its possible side effects include: hives or other rashes, swelling of the mouth, tongue, lips, or face shortness of breath, tightness in the chest.

View Lastest Price from Sermorelin manufacturers

Update time	Product	Price	Min. Order	Purity	Supply Ability	Manufacturer
2025-11-02	Sermorelin 86168-78-7	US $0.00-0.00 / G	1G	99%	1 ton/year	Forest chemical technology
2025-11-01	Sermorelin 5mg 10mg(GHRH (1-29) 86168-78-7	US $55.00-50.00 / kit	1kit	99%	10000kits	Shenzhen Aoxi Technology Co., Ltd.
2025-11-01	Sermorelin	US $1.00 / kit	1kit	99.9%	200	.GZ HONESTCHEM CO.,LTD

Sermorelin
86168-78-7
US $0.00-0.00 / G
99%
Forest chemical technology

Sermorelin 5mg 10mg(GHRH (1-29)
86168-78-7
US $55.00-50.00 / kit
99%
Shenzhen Aoxi Technology Co., Ltd.

Sermorelin
US $1.00 / kit
99.9%
.GZ HONESTCHEM CO.,LTD

86168-78-7(Sermorelin)Related Search:

Taltirelin Degarelix BUSERELIN Elcatonin Calcitonin salmon

Nesiritide acetate Thymopentin Triptorelin acetate Pramlintide acetate GLP-1 (7-37)

Eptifibatide Thymalfasin Leuprorelin GROWTH HORMONE, HUMAN SERMORELIN (HUMAN)

Sermorelin Sermorelin acetate SERMORELIN (HUMAN)

1of4

SERMORELIN YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN growth hormone releasing factor*fragment 1-29 ami H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN GRF (1-29) AMIDE (HUMAN) GROWTH HORMONE RELEASING FACTOR, FRAGMENT 1-29 AMIDE GROWTH HORMONE RELEASING FACTOR FRAGMENT 1-29 AMIDE HUMAN GHRF (1-29), AMIDE, HUMAN Green tea powdered extract SERMORELIN, GROWTH HORMONE RELEASING FACTOR FRAGMENT 1-29 AMIDE somatoliberin fragment 1-29 amide, human Sermorelin Aceta TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-ASN-ARG-GLN-GLN-GLY-GLU-ARG-ASN-GLN-GLU-GLN-GLY-ALA-LYS-VAL-ARG-LEU-NH2: YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 [D-Ala2]-Growth Hormone Releasing Factor, GRF (1-29), amide, human GRF (1-29) aMide (huMan) SerMorelin Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Thr-Arg-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH{2} 1-29-SOMATOLIBERIN (HUMAN PANCREATIC ISLET), 29-L-ARGININAMIDE- Sermelin Acetate Sermorelin,GHRH (1-29),Growth Hormone Releasing Factor Fragment 1-29 amide human, BR Peptides Sermorelin Base Sermorelin Acetate Sermorelin USP/EP/BP 86168-78-7 Sermorelin Sermorelin Acetate(net) Semorelin Sermorelin (GRF (1-29) amide) Sermorelin，GHRH (1-29)，Growth Hormone Releasing Factor Fragment 1-29 amide human Sermorellin Sermorelin 5mg 10mg(GHRH (1-29) Sermorelin (GHRH (1-29) Semonelin Acetale 86168-78-7 86186-78-7 C149H246N44O42S Releasing Factors Peptides GH-RH Biochemicals and Reagents Amino Acids and Peptides BioChemical Peptide Amino Acid Derivatives GH-RHObesity Research GH-RHPeptides for Cell Biology Growth Hormone Releasing Factors Neuropeptides Neurotransmission (Obesity) Releasing Factors Sermorelin 86168-78-7