ChemicalBook
Chinese Japanese Germany Korea

PACAP 6-38

PACAP 6-38
PACAP 6-38 structure
CAS No.
143748-18-9
Chemical Name:
PACAP 6-38
Synonyms
PACAP 6-38;PACAP-38 (6-38);PACAP (6-38), HUMAN, OVINE, RAT;PACAP (HUMAN, 6-38) (OVINE, RAT);PACAP (6-38) (HUMAN, SHEEP, RAT);FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2;PACAP (6-38), AMIDE, HUMAN, OVINE, RAT;PACAP-38 (6-38) (HUMAN, CHICKEN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE ACTIVATING POLYPEPTIDE (6-38) (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (6-38), HUMAN, OVINE, RAT
CBNumber:
CB9698459
Molecular Formula:
C182H300N56O45S
Formula Weight:
4024.7426
MOL File:
143748-18-9.mol

PACAP 6-38 Properties

storage temp. 
-15°C

PACAP 6-38 price More Price(2)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Alfa Aesar J66342 PACAP (6-38), human, ovine, rat 143748-18-9 0.5mg $229 2020-06-24 Buy
Alfa Aesar J66342 PACAP (6-38), human, ovine, rat 143748-18-9 1mg $369 2020-06-24 Buy

PACAP 6-38 Suppliers

Global( 74)Suppliers
Supplier Tel Fax Email Country ProdList Advantage
Chongqing Chemdad Co.,Ltd
+86-19923101450
sales@chemdad.com CHINA 4001 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
career henan chemical co
0086-371-86658258
0086-371-86658258 factory@coreychem.com CHINA 29643 58
Neostar United (Changzhou) Industrial Co., Ltd.
+0086-519-85557386
+0086-519-85557389 marketing1@neostarunited.com CHINA 4111 58
3B Pharmachem (Wuhan) International Co.,Ltd. 18930552037 821-50328103-801
86-21-50328109 3bsc@sina.com China 15880 69
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202-
+86-21-64545202 info@hanhonggroup.com;info@hanhonggroup.com China 43258 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32358 50
Cellmano Biotech Limited 18156095617 0551-65326643
+86-551-65326641 info@cellmano.com China 1002 55
Wuxi Zhongkun Biochemical Technology Co., Ltd. 18013409632
051085625359 sales@reading-chemicals.com; China 15200 58

View Lastest Price from PACAP 6-38 manufacturers

Image Release date Product Price Min. Order Purity Supply Ability Manufacturer
2020-02-13 PACAP 6-38
143748-18-9
US $7.00 / KG 1KG 99% 100kg Career Henan Chemical Co

143748-18-9(PACAP 6-38)Related Search:


  • PITUITARY ADENYLATE CYCLASE ACTIVATING PEPTIDE (6-38), HUMAN, OVINE, RAT
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (6-38) (HUMAN, CHICKEN, MOUSE, OVINE, PORCINE, RAT)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (6-38) AMIDE (HUMAN, OVINE, RAT)
  • PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (HUMAN, 6-38) OVINE, RAT
  • PACAP-38 (6-38) (HUMAN, CHICKEN, MOUSE, OVINE, PORCINE, RAT)
  • PACAP (6-38), AMIDE, HUMAN, OVINE, RAT
  • PACAP (6-38), HUMAN, OVINE, RAT
  • PACAP (6-38) (HUMAN, SHEEP, RAT)
  • PACAP (HUMAN, 6-38) (OVINE, RAT)
  • His-Ser-Asp-Gly-Ile-Phe-Thr-Ap-Ser-Tyr-Ser-Arg_tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-ILE-LYS-ASN-LYS-NH2: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2
  • PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • PACAP 6-38
  • Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38)(huMan, chicken, Mouse, ovine, porcine, rat), Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (huMan, chicken, Mouse, ovine, porcine, rat)
  • FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
  • HIS-SER-ASP-GLY-ILE-PHE-THR-AP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • H-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2
  • PITUITARY ADENYLATE ACTIVATING POLYPEPTIDE (6-38) (HUMAN, OVINE, RAT)
  • PACAP-38 (6-38)
  • 143748-18-9
  • C203H331N63O65S
  • C182H300N56O45S
  • Peptide
Copyright 2017 © ChemicalBook. All rights reserved