Teriparatide acetate
|
- $88 - $5690
- Product name: Teriparatide acetate
- CAS: 52232-67-4
- MF: C172H278N52O47S2
- MW: 3890.49792
- EINECS:640-978-1
- MDL Number:MFCD00149013
- Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
26 prices
Selected condition:
Brand
- American Custom Chemicals Corporation
- ApexBio Technology
- Chemenu
- Crysdot
- Medical Isotopes, Inc.
- Sigma-Aldrich
- Tocris
- TRC
Package
- 0.5mg
- Y0001895
- Y0001916
- 0.1mg
- 1
- 23-5501-1mg
- 1MG
- 5mg
- 10mg
- 25mg
- 50mg
- 100mg
- 1 mg
- 1.3 mg
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberSHG0006488
- Product descriptionPARATHYROID HORMONE (1-34) 95.00%
- Packaging1MG
- Price$883.11
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging1mg
- Price$88
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging5mg
- Price$132
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging10mg
- Price$167
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberA1129
- Product descriptionParathyroid Hormone (1-34), human
- Packaging25mg
- Price$375
- Updated2021-12-16
- Buy
- ManufacturerChemenu
- Product numberCM101690
- Product descriptionTeriparatide 97%
- Packaging50mg
- Price$290
- Updated2021-12-16
- Buy
- ManufacturerChemenu
- Product numberCM101690
- Product descriptionTeriparatide 97%
- Packaging100mg
- Price$561
- Updated2021-12-16
- Buy
- ManufacturerCrysdot
- Product numberCD00003640
- Product descriptionTeriparatideAcetate 97%
- Packaging5mg
- Price$99
- Updated2021-12-16
- Buy
- ManufacturerCrysdot
- Product numberCD00003640
- Product descriptionTeriparatideAcetate 97%
- Packaging10mg
- Price$149
- Updated2021-12-16
- Buy
- ManufacturerCrysdot
- Product numberCD00003640
- Product descriptionTeriparatideAcetate 97%
- Packaging25mg
- Price$248
- Updated2021-12-16
- Buy
- ManufacturerCrysdot
- Product numberCD00003640
- Product descriptionTeriparatideAcetate 97%
- Packaging50mg
- Price$396
- Updated2021-12-16
- Buy
- ManufacturerCrysdot
- Product numberCD00003640
- Product descriptionTeriparatideAcetate 97%
- Packaging100mg
- Price$594
- Updated2021-12-16
- Buy
- ManufacturerMedical Isotopes, Inc.
- Product number17715
- Product descriptionTeriparatide
- Packaging25mg
- Price$5690
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberP3796
- Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
- Packaging0.1mg
- Price$169.83
- Updated2025-07-31
- Buy
- ManufacturerSigma-Aldrich
- Product numberY0001916
- Product descriptionTeriparatide European Pharmacopoeia (EP) Reference Standard
- PackagingY0001916
- Price$201
- Updated2024-03-01
- Buy
- ManufacturerSigma-Aldrich
- Product numberY0001916
- Product descriptionTeriparatide European Pharmacopoeia (EP) Reference Standard
- Packaging1 mg
- Price$215
- Updated2025-07-31
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| American Custom Chemicals Corporation | SHG0006488 | PARATHYROID HORMONE (1-34) 95.00% | 1MG | $883.11 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 1mg | $88 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 5mg | $132 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 10mg | $167 | 2021-12-16 | Buy |
| ApexBio Technology | A1129 | Parathyroid Hormone (1-34), human | 25mg | $375 | 2021-12-16 | Buy |
| Chemenu | CM101690 | Teriparatide 97% | 50mg | $290 | 2021-12-16 | Buy |
| Chemenu | CM101690 | Teriparatide 97% | 100mg | $561 | 2021-12-16 | Buy |
| Crysdot | CD00003640 | TeriparatideAcetate 97% | 5mg | $99 | 2021-12-16 | Buy |
| Crysdot | CD00003640 | TeriparatideAcetate 97% | 10mg | $149 | 2021-12-16 | Buy |
| Crysdot | CD00003640 | TeriparatideAcetate 97% | 25mg | $248 | 2021-12-16 | Buy |
| Crysdot | CD00003640 | TeriparatideAcetate 97% | 50mg | $396 | 2021-12-16 | Buy |
| Crysdot | CD00003640 | TeriparatideAcetate 97% | 100mg | $594 | 2021-12-16 | Buy |
| Medical Isotopes, Inc. | 17715 | Teriparatide | 25mg | $5690 | 2021-12-16 | Buy |
| Sigma-Aldrich | P3796 | Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder | 0.1mg | $169.83 | 2025-07-31 | Buy |
| Sigma-Aldrich | Y0001916 | Teriparatide European Pharmacopoeia (EP) Reference Standard | Y0001916 | $201 | 2024-03-01 | Buy |
| Sigma-Aldrich | Y0001916 | Teriparatide European Pharmacopoeia (EP) Reference Standard | 1 mg | $215 | 2025-07-31 | Buy |
Properties
Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
biological source :human
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)
Safety Information
| Symbol(GHS): |
|
|||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | |||||||||||||||||||||
| Hazard statements: |
|
|||||||||||||||||||||
| Precautionary statements: |
|
Description
A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.Related product price
- Oxytocin
$25.6-2395.3 - Melanotan II
$35-3154.84 - Cosyntropin
$71.8-1162.98
Suppliers and manufacturers
Sea Biological Co.,LTD
Cellmano Biotech Limited
Rixing Chemical CO.,LTD.
Wuhan Biocar Pharmacy CO.,Ltd.
Kebeilai Pharmaceutical Biotech Co., Ltd.




