ChemicalBook Chinese Germany Japanese Korean

BOC Sciences Company Information

Company Name:    BOC Sciences
Tel:    -16314854226;
Email:    inquiry@bocsci.com
Nationality:    United States
WebSite:    https://www.bocsci.com/
Product List:    19654
141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197

Product List
CTNNB1 (29-37)
DAPK2 protein (1-9)
Fanconi anemia group M protein (201-214)
D-dopachrome decarboxylase (89-97)
Fructose-bisphosphate aldolase A isoform 2 (326-338)
Cyclin-dependent kinase 4 (924-932)
E3 ubiquitin-protein ligase UBR4 (329-337)
Cellular tumor antigen p53 (193-204)
DNA-dependent protein kinase catalytic subunit (2836-2844)
Cyclosporin A-Derivative 2 156047-45-9
D-γ-Glutamyl-D-glutamic acid 4553-17-7
Cys-TAT (47-57) 583836-55-9
CDK4-R24C (23-32)
Centrosome-associated protein 350 (2297-2305)
DNA-binding protein RFX6 (414-431)
G1/S-specific cyclin-D1 (101-109)
Ephrin type-A receptor 3 (356-367)
CD59 glycoprotein precursor (106-114)
Cyclin-A1 (271-279)
Exendin derivative 1
EELVDYKSCAHDWVY
FN1 (2050-2063)
dek-can fusion protein (342-357)
DNA repair protein RAD50 (1281-1289)
Coiled-coil and C2 domain-containing protein 2A isoform a (1275-1287)
ERBB2IP protein (1003-1018)
Fructose-bisphosphate aldolase A isoform 2 (207-222)
Dickkopf-related protein 1 (20-29)
Chondroitin sulfate proteoglycan 4 (693-708)
Coiled-coil domain-containing protein 110 (499-508)
E3 ubiquitin-protein ligase RNF43 (721-729)
Ewing Tumor EZH2 (666-674)
Eptifibatide Impurity 2
Fmoc-Glu(AspG3)-OH 1858229-70-5
D-Ala-L-Leu-D-Asp-L-Arg-Phe-D-Glu (iso)-D-Ala
EFTUD2 (668-677)
Eukaryotic translation initiation factor 4 gamma 1 (719-727)
F-box protein FBL5 (227-255)
Eukaryotic translation initiation factor 4 gamma 1 (1248-1256)
CD20 (188-196)
Cellular tumor antigen p53 (99-107)
Cytochrome p450 1B1 (239-248)
DRIM protein (299-307)
FliC, Serotype a (427-441), S.paratyphi A 857678-38-7
Cyclo(-L-Ala-L-Ile) 35590-69-3
CGEHSDYKHY
Crebtide 149155-45-3
Fibronectin type III domain-containing protein 3B (292-300)
CGI-55 protein (21-31)
Eukaryotic translation elongation factor 1 alpha 1 (115-129)
Eph-like receptor tyrosine kinase hEphB1b (422-432)
Cyclin-A1 (385-395)
Death-inducer obliterator 1 (941-951)
E3 ubiquitin-protein ligase Mdm2 (53-60)
G3-C12 848301-94-0
EFSLVVVRYPQYGVG
ETV6-AML1 fusion protein (334-342)
Cysteine-rich protein 2 isoform 2 (133-147)
Chondromodulin-I (319-327)
Coiled-coil domain-containing protein 110 (770-778)
EDDR1 (867-876)
Eptifibatide Impurity 3
D-Ala-L-Leu-D-Asp-L-Arg-Phe-D-Glu (iso)-D-Ala, cyclic form
FITC-Ahx-Arg-Gly-Asp
D-Lys(Z)-Pro-Arg-pNA 108963-69-5
Cullin-7 (1271-1279)
CHMP7 protein, partial (48-62)
FAST kinase domain-containing protein 1 isoform 1 (497-514)
Centriolin (2174-2182)
Cleavage and polyadenylation specificity factor subunit 1 (250-258)
Epidermal growth factor receptor (478-488)
CLIP 86-100 648881-58-7
EAVRLFIEWLKNGGPSSGAPPPS
CLPP (240-248)
Eukaryotic initiation factor 4A-III (110-119)
Cell division cycle protein 27 homolog (760-771)
Cellular tumor antigen p53 (153-165)
DNA ligase 3 isoform alpha precursor (790-806)
Eptifibatide Impurity 1
ETV6-AML1 fusion protein (332-346)
DEAD (Asp-Glu-Ala-Asp) box polypeptide 53 (502-513)
C-Jun-amino-terminal kinase-interacting protein 2 (683-692)
Cellular tumor antigen p53 (217-225)
Cleavage and polyadenylation specificity factor subunit 1 (1360-1369)
Epithelial cell adhesion molecule (173-181)
Chondrosarcoma-associated gene 2/3 protein (34-48)
Cullin-7 (915-923)
EGF-R (1138-1147)
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
EEF2 (581-589)
FITC-L-methionine
Cyclo(Arg-Pro)
D-Lys(Z)-Pro-Arg-pNA diacetate 108963-70-8
FBXO41 protein, partial (284-297)
cell division cycle 45-like (556-564)
G1/S-specific cyclin-D1 (198-212)
Coiled-coil domain-containing protein 110 (196-204)
E3 ubiquitin-protein ligase RNF43 (11-19(20))
ER membrane protein complex subunit 1 isoform 3 precursor (640-648)
Chlorotoxin (linear)
141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197

Copyright 2007©  ChemicalBook. All rights reserved.