BOC Sciences회사는 제품 목록을 제공합니다.

회사 명:BOC Sciences
전화:-
이메일:inquiry@bocsci.com
국적:United States
URL: https://www.bocsci.com/
총 제품 수:19743

제품 카탈로그

Receptor-type tyrosine-protein phosphatase kappa (667-682)
Protein SSX2 (101-111)
Protein SSX2 (41-49)
Sarcoma antigen 1 (715-723)
Talin (777-785)
Receptor tyrosine-protein kinase erbB-2 (63-71)
Receptor tyrosine-protein kinase erbB-2 (391-399)
(S)-2-hydroxy-3-(2-methylphenyl)-propionic acid458528-68-2C10H12O3
Receptor-type tyrosine-protein kinase FLT3 (591-600)
Putative protein product of HMFN1045 (253-264)
Protein SSX4 (61-80)
PSMA/PSM-P1 (4-12)
Telomerase reverse transcriptase (672-686)
Serine protease hepsin (229-237)
Receptor tyrosine-protein kinase erbB-2 (650-658)
TAG-2 (42-50)
Rho guanine nucleotide exchange factor 17 (425-438)
RER1 protein (80-91)
Small subunit processome component 20 homolog (626-634)
Protein SSX4 (31-50)
PSCA (14-22)
Survivin (18-27)
Telomerase reverse transcriptase (865-873)
Receptor tyrosine-protein kinase erbB-2 (665-673)
Receptor tyrosine-protein kinase erbB-2 (369-377)
SYSMEHFRWGKPSC??H???N??O??S
Telomerase reverse transcriptase (461-469)
Sodium-coupled monocarboxylate transporter 2 (343-356)
Serine/threonine-protein kinase B-raf (586-614)
Protein SSX2 (45-58)
Regulator of G-protein signaling 5 (5-13)
Secernin-1 (196-204)
Receptor tyrosine-protein kinase erbB-2 (754-762)
Receptor tyrosine-protein kinase erbB-2 (1023-1032)
Rhodopsin Epitope TagC??H??N??O??
Telomerase reverse transcriptase (540-548)
SSA protein SS-56 (55-64)
Ras-related protein Rab-27A (178-186)
Protein phosphatase 1 regulatory subunit 3B (172-180)
Prostatic acid phosphatase (112-120)
Protein SSX2 (19-34)
Rho-related GTP-binding protein RhoC (176-185)
Serine protease hepsin (191-199)
Receptor tyrosine-protein kinase erbB-2 (466-474)
[pThr3]-CDK5 Substrate1670273-47-8C53H100N15O15P
TDSP5
Serine/threonine-protein kinase mTOR (89-98)
Protein OS-9 (438-446)
Protein enabled homolog (502-510)
Protein SSX4 (41-60)
PSM P2 (711-719)
Survivin (80-88)
Receptor tyrosine-protein kinase erbB-2 (689-697)
PSMA-PEG42256069-92-6C23H42N4O12
(R)-2-hydroxy-3-(2-methylphenyl)-propionic acid1932808-80-4C10H12O3
Telomerase Reverse Transcriptase (674-683)
Ribosomal protein S26 (47-61)
Receptor tyrosine-protein kinase erbB-2 precursor (369-386)
Protein timeless homolog (848-856)
Small nuclear ribonucleoprotein Sm D1 (11-19)
Prostatic acid phosphatase (18-26)
Ras-related protein Rab-38 (50-58)
Protein SSX4 (151-170)
Regulator of G-protein signaling 5 (74-83)
Sperm surface protein Sp17 (103-111)
Receptor tyrosine-protein kinase erbB-2 (48-56)
Receptor tyrosine-protein kinase erbB-2 (5-13)
STh118447-40-8C79H112N22O30S6
(S)-2-hydroxy-3-(3-methylphenyl)-propionic acid458528-71-7C10H12O3
St-Ht31 P252869-81-1C127H209N29O39
Proto-oncogene PIM1 (191-199)
Structure-specific endonuclease subunit SLX4 (603-615)
Rabenosyn-5 (541-552)
Prostatic acid phosphatase (299-307)
Retinal dehydrogenase 1 (88-96)
Protein enabled homolog (443-451)
Protein SSX2 (37-54)
Ribosome-binding protein 1 (879-887)
Receptor tyrosine-protein kinase erbB-2 (402-410)
Protein SSX4 (51-70)
PSMA (27-38)
Survivin-3A (96-104)
Telomerare Reverse Transcriptase (hTRT) (653-661)
Serine protease hepsin (268-276)
Receptor tyrosine-protein kinase erbB-2 (435-443)
TAMRA-β-Amyloid (1-42), human1802087-80-4
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Siyry178561-37-0C50H71N11O13
TAG-1 A2 (78-86)
Secretin (5-27) (Porcine)19665-15-7C115H200N38O34
RPL8 protein (31-41)
Protein SSX2 (45-59)
SYT-SSX1 or -SSX2 fusion protein (402-410 (SYT))
Protein SSX4 (161-180)
Surface IgG (sA20-Ig) of A20 (106-114)
Telomerase reverse transcriptase (766-780)
Receptor tyrosine-protein kinase erbB-2 (952-961)
Receptor tyrosine-protein kinase erbB-2 (654-662)
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor 1142-1153141171-54-2C72H110N19O33P3
(R)-2-hydroxy-3-(3-methylphenyl)-propionic acid374119-33-2C10H12O3
Copyright 2019 © ChemicalBook. All rights reserved