ChemicalBook Chinese

Company Information
Company Name:    Chem-Impex International, Inc.
Tel:    800 869-9290 US and Canada only
Fax:    630 766-2218
Email:   
Nationality:    United States
WebSite:    www.chemimpex.com
Product List:    6739
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68

Product List
MES 1912-28-3
4-Chlorophenethylamine 156-41-2
H-TRP-PHE-TYR-SER(PO3H2)-PRO-ARG-AMC
2-(Boc-aminomethyl)-piperidine 141774-61-0
Phenylhydrazine hydrochloride 59-88-1
PHT-LYS-OH 41440-64-6
(DES-PYR1)-LHRH 38280-53-4
ALPHA-D-CELLOBIOSE OCTAACETATE 3616-19-1
Sodium cacodylate trihydrate 6131-99-3
2H-PYRAN-3(4H)-ONE, DIHYDRO- 23462-75-1
2-ETHOXY-5-[(MORPHOLINE-4-CARBONYL)-AMINO]-BENZENESULFONYL CHLORIDE 680618-10-4
AC-LYS(AC)-D-ALA-D-ALA-OH 24570-39-6
Z-GLY-GLY-TRP-OH 83798-91-8
ANTI-KENTSIN 73430-00-9
4-METHYLUMBELLIFERYL ALPHA-L-RHAMNOPYRANOSIDE 106488-05-5
2-HYDRAZINO-1,3-BENZOXAZOLE 15062-88-1
2-AMINOOCTANE 693-16-3
SAR-PRO-OH
BOC-BETA-HOHYP(BZL)-OH DCHA
3,5-Difluorobenzyl bromide 141776-91-2
H-GLU(OME)-OTBU HCL
BOC-ALA-ALA-GLY-PNA 90037-94-8
ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 133514-43-9
FMOC-TIC-WANG RESIN
5-Hydroxytryptophan 56-69-9
5-CHLORO-2-FLUORO-BENZAMIDINE HYDROCHLORIDE 1187929-52-7
NEUROPEPTIDE SF (HUMAN) 192387-39-6
LIGHT GREEN SF YELLOWISH 5141-20-8
Doxorubicin hydrochloride 25316-40-9
H-TYR(TRT)-2-CHLOROTRITYL RESIN
Tris(hydroxymethyl)aminomethane acetate salt 6850-28-8
(PYR4,CYS(H-CYS-OH)6,ARG8)-VASOPRESSIN (4-8)
Salicylaldoxime 94-67-7
4-Amidinophenylmethanesulfonyl fluoride hydrochloride 74938-88-8
H-ASP-PHE-ASP-MET-LEU-ARG-CYS-MET-LEU-GLY-ARG-VAL-PHE-ARG-PRO-CYS-TRP-GLN-TYR-OH 160201-86-5
CALCIUM HYDRIDE 7789-78-8
H-TYR-GLY-ARG-LYS-LYS-ARG-ARG-GLN-ARG-ARG-ARG-OH 191936-91-1
H-VAL-D-PRO-PRO-OH
3-INDOXYL PHOSPHATE DISODIUM SALT 3318-43-2
FMOC-ASN(TRT)-GLY-OH
4-BROMO-2,3-DIHYDRO-INDOLE-1-CARBOXYLIC ACID TERT-BUTYL ESTER 885272-46-8
(D-PHE12,NLE21,38,ALPHA-ME-LEU37)-CORTICOTROPIN-RELEASING FACTOR (12-41) (HUMAN, RAT)
H-GLY-PRO-GLY-OH 2441-63-6
7-Bromoindole 51417-51-7
1-BOC-3-BROMO-5-FLUORO-INDAZOLE 885271-57-8
H-TYR-D-MET(O)-GLY-N-ME-PHENYLALANINOL
PHT-GLY-OTBU 6297-93-4
H-TYR-GLY-GLY-PHE-LEU-LYS-OH ACETATE SALT 83404-43-7
1-BOC-3-FORMYL-4-OXO-PIPERIDINE 100501-55-1
H-CYS-TYR-ILE-GLN-ASN-CYS-PRO-LEU-GLY-NH-CH2CH2F
FMOC-D-TIC-WANG RESIN
FMOC-3,4-DEHYDRO-VAL-OH
Cytidine 5'-triphosphate disodium salt 36051-68-0
BOC-L-3-NITROPHENYLALANINE 131980-29-5
H-ALA-SER-ALA-SER-SER-LEU-MET-ASP-LYS-GLU-ALA-VAL-TYR-PHE-ALA-HIS-LEU-ASP-ILE-ILE-TRP-OH 121204-87-3
(R)-GAMMA-(4-IODO-BENZYL)-L-PROLINE-HCL
2,3,5-TRIFLUORO-PYRIDIN-4-YLAMINE 105252-95-7
H-CYS-ASP-PRO-GLY-TYR-ILE-GLY-SER-ARG-NH2 110590-61-9
NPYS-GLY-OH 77357-00-7
Ubidecarenone 303-98-0
1-[2-(2-METHOXY-ETHOXY)-PHENYL]-PIPERAZINE 891782-62-0
2-Cyano-3-nitropyridine 51315-07-2
HATU 148893-10-1
BIOTINYL-NEUROPEPTIDE Y (HUMAN, RAT) 213779-13-6
Ethyl indole-3-carboxylate 776-41-0
(VAL3)-BETA-CASOMORPHIN (1-4) AMIDE (BOVINE) ACETATE SALT 104180-22-5
BENZYL (+/-)-TRANS-N-BOC-4-METHYL-PIPERIDINE-2-CARBOXYLATE 339183-92-5
BOC-3-(3'-QUINOLYL)-D-ALANINE 135101-19-8
5-AMINOMETHYL-PYRIDINE-2-CARBONITRILE 182291-88-9
CNP-53 (PORCINE, RAT)
5-NITRO-1H-INDAZOLE-7-CARBOXYLIC ACID METHYL ESTER 632291-85-1
2-Methoxybenzonitrile 6609-56-9
3-CYANO-L-PHENYLALANINE HCL
6-CHLORO-3-INDOLYL ACETATE 114305-99-6
1-CYCLOHEXYL-3-ETHYL-6-FLUORO-1H-INDAZOLE 224048-17-3
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 357952-10-4
H-LEU-TYR-ILE-ASP-PHE-ARG-LYS-ASP-LEU-GLY-OH
GRB2 SH2 DOMAIN LIGAND
3-CHLORO-5-HYDROXY-BENZOIC ACID 53984-36-4
METHYL 3-FORMYLINDOLE-6-CARBOXYLATE 133831-28-4
Tetrahydropyran-4-carbaldehyde 50675-18-8
5-FLUOROINDOLE-3-ACETIC ACID HYDRAZIDE 376646-57-0
D-HISTIDINE HYDROCHLORIDE MONOHYDRATE
H-D-GLU(OTBU)-OH 45125-00-6
FMOC-PRO-OPFP 86060-90-4
H-TRP-2-CHLOROTRITYL RESIN
FMOC-D-ALLO-ILE-OH 118904-37-3
ALPHA-AMINOISOBUTYRIC ACID T-BUTYL ESTER 4512-32-7
H-ALA-D-ALA-OH 3695-80-5
FMOC-3-AMINOPENTANE-3-CARBOXYLIC ACID
Ammonium citrate dibasic 3012-65-5
1,12-Dodecanediamine 2783-17-7
FMOC-D-LYS(Z)-OH 110990-07-3
Z-D-ASP(OBZL)-OH 5241-62-3
PHENACETURIC ACID 500-98-1
PROLINOL 2-CHLOROTRITYL RESIN
Z-D-GLU(OME)-OH 27025-24-7
(S)-(-)-2-Azetidinecarboxylic acid 2133-34-8
AC-LYS (AC)-OH 499-86-5
Boc-L-Glutamic acid 1-benzyl ester 30924-93-7
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68

Copyright 2007©  ChemicalBook. All rights reserved.