Product Categories
| Country: | China |
|---|---|
| Tel: | |
| Mobile: | 19375158599 |
| E-mail: | info@molchanges.com |
| QQ: | |
| Skype: | Chat Now! |
| Address: | Changsha Longping Bio-Industrial Park Provincial Research Center Factory |
|
MOL Changes has unique technical capabilities in peptide synthesis, peptide modification, protein and peptide labeling, and cellular reactions. The company's technical staff comes from the fields of organic chemistry and biology, and the technical leadership consists of graduate students and PhDs. The company has mastered a wide range of peptide synthesis methods, including solid-phase peptide synthesis, liquid-phase peptide synthesis, combined liquid-solid peptide synthesis, reverse solid-phase peptide synthesis and microbial fermentation methods. microbial fermentation methods.
We offer a wide range of synthetic R&D services for drug discovery, biological research and bioengineering, and provide scientists with viable pathways in the process of new drug development.
The value of peptide synthesis we provide goes beyond long sequences and high purity, as we have unique techniques for solving complex and difficult peptide sequences, overcoming compatibility issues during peptide synthesis, and assisting our clients with a comprehensive optimization strategy for the research process.
Our R&D, synthesis, purification, lyophilization, and testing are all done in sterile laboratories. Currently, we have set up research laboratories and branch offices in Changsha, Zhuzhou, and Hong Kong, and our customers are mainly from the United States, Canada, Russia, the United Kingdom, Australia, Sweden, Norway, and South Korea, which include biochemistry colleges, biochemical research institutes, medical research institutes, and bio-scientists.
In the future, MOL Changes will continue to focus on technology research and development, with the aim of becoming a leading company in the field of single peptide products, and establishing a strong technological and cost advantage in the field, which will help our customers to occupy a dominant position in the market.
|
|
| Product Name | MF | CAS | Details |
|---|
| Aurein2.4 | C77H133N19O19 | Details |
| aurein 3.1 | Details |
| SDV-Exendin-3/4 | Details |
| AZP-531 | C40H63N15O13 | 1088543-62-7 | Details |
| Aurein | Details |
| abaecin | 123997-18-2 | Details |
| aurein 4.1 | Details |
| FMRF-like Neuropeptide | C59H86N16O14 | 121801-61-4 | Details |
| D-Ala2] Met-Enkephalin | C28H37N5O7S | 61370-87-4 | Details |
| MARKSubstrate | C60H108N18O21 | 847991-34-8 | Details |
| TAK-448 | C64H90F3N17O16 | 1433222-47-9 | Details |
| Gramicidin S | C60H92N12O10 | 113-73-5 | Details |
| ADP355 peptide | Details |
| Lys-(Hyp3)-Bradykinin | C56H85N17O13 | 113662-39-8 | Details |
| Guangxitoxin 1E | C178H248N44O45S7 | 1233152-82-3 | Details |
| Adipokinetic Hormone (AKH) (24-32), locust | C44H60N10O12 | 53027-55-7 | Details |
| Met-Enkephalin, amide | C27H36N6O6S | 60117-17-1 | Details |
| CAP18 (rabbit) | 152742-15-9 | Details |
| D-Arg0,Hyp2,3,D-Phe7]-Bradykinin | C60H87N19O14 | 111929-26-1 | Details |
| Neuropeptide K, porcine | C175H284N52O52S | 106441-70-7 | Details |
| Pancreastatin, porcine | C214H330N68O76S | 106477-83-2 | Details |
| IFN-αReceptorRecognitionPeptide1 | C35H59N13O12S | 153840-64-3 | Details |
| D-Trp32]-Neuropeptide Y (porcine) | 178861-83-1 | Details |
| Allatostatin VI | C61H94N18O16 | 123209-95-0 | Details |
| β-Amyloid (12-20) | C57H83N15O11 | 134649-29-9 | Details |
| β-Amyloid (13-27) | C84H126N24O24 | 148270-13-7 | Details |
| β-Amyloid (1-34) | 186359-65-9 | Details |
| β-Amyloid (10-35), amide | C133H205N35O36S | 181427-66-7 | Details |
| β-Amyloid (11-22) | C70H102N18O18 | 885323-98-8 | Details |
| A20FMDV2 | C93H163N31O28 | 932699-03-1 | Details |
| H-γ-Glu-Abu-Gly-OH | Details |
| Taspoglutide | C152H232N40O45 | 275371-94-3 | Details |
| C-Reactive Protein (CRP) 174-185 | C62H93N13O16 | 160369-86-8 | Details |
| NoxA1ds | C50H88N14O15 | 1435893-78-9 | Details |
| Ala113]-MBP (104-118) | C67H104N20O19 | 99026-78-5 | Details |
| SEB Domain (144-153) | C50H90N14O17 | 210229-94-0 | Details |
| DPCAJ1951 | C76H127N23O19 | 943519-33-3 | Details |
| RAGE antagonist | C57H101N13O17S | 1092460-91-7 | Details |
| Ala107]-MBP (104-118) | C67H104N20O19 | 99026-77-4 | Details |
| RVD-Hpα | C65H105N19O17 | 1193362-76-3 | Details |
| Angstrom6/A6 Peptide | C39H62N10O15 | 220334-14-5 | Details |
| Big Gastrin I Human | C176H251N43O53S1 | 60675-77-6 | Details |
| ELA-11(human) | C58H90N16O13S2 | 1784687-32-6 | Details |
| Acetyl Pentapeptide-1 | C32H51N9O10 | 97530-32-0 | Details |
| [D-Trp7,9,10]-Substance P | C79H105N21O13S | 89430-38-6 | Details |
| OrphaninFQ(1-11) | C49H75N15O14 | 178249-41-7 | Details |
| AUNP-12 | C142H226N40O48 | 1353563-85-5 | Details |
| Apidaecin IB | C95H150N32O23 | 123276-94-8 | Details |
| TAT (48-57) | C55H109N31O12 | 253141-50-3 | Details |
| AT-1002 | C32H53N9O7S | 835872-35-0 | Details |
| Acein | C43H68N10O13 | Details |
| [(pF)Phe4]Nociceptin(1-13)NH2 | C61H99FN22O15 | 380620-88-2 | Details |
| Balixafortide | C84H118N24O21S2 | 1051366-32-5 | Details |
| Dynorphin B (1-13) | C74H115N21O17 | 85006-82-2 | Details |
| ADH-1 | C22H34N8O6S2 | 229971-81-7 | Details |
| Goralatide | C20H33N5O9 | 127103-11-1 | Details |
| Reltecimod | C46H72N10O15S | 1447799-33-8 | Details |
| MLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLL | 122304-04-5 | Details |
| Basifungin | C60H92N8O11 | 127785-64-2 | Details |
| TT 232 | C45H58N10O9S2 | 147159-51-1 | Details |
| Edratide | C111H149N27O28 | 433922-67-9 | Details |
| P-113 | C71H110N28O13 | 190673-58-6 | Details |
| Big Endothelin-1 Fragment (22-38) (human) | C80H125N23O25 | 124932-61-2 | Details |
| AD 01 | C115H187N33O42 | 959961-23-0 | Details |
| Lys4] Sarafotoxin S6c | C103H151N27O37S5 | 116495-45-5 | Details |
| Big Endothelin -1 (1-39), porcine | C192H287N49O58S5 | 124834-83-9 | Details |
| Tyr-Uroguanylin (rat) | C69H109N17O27S4 | Details |
| Peptide T | C35H55N9O16 | 106362-32-7 | Details |
| Calcitonin Gene Related Peptide, chicken | 104364-57-0 | Details |
| hIRBP651-670 | Details |
| Enterostatin | C21H36N8O6 | 117830-79-2 | Details |
| Substance P (1-4) | C22H40N8O5 | 57468-16-3 | Details |
| 11R-VIVIT | C147H259N67O36S | 592517-80-1 | Details |
| CyclicMKEY | C113H174N28O34S2 | 934385-55-4 | Details |
| Substance P (3-11)/Nona-Substance P | C52H79N13O11S | 51165-11-8 | Details |
| Sar9] Substance P | C64H100N18O13S | 77128-75-7 | Details |
| LY2510924 | C62H88N14O10 | 1088715-84-7 | Details |
| D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14) | C44H64N14O10S2 | 349657-39-2 | Details |
| Substance P (9-11) | C13H26N4O3S | 4652-64-6 | Details |
| MC-Val-Cit-PABC-PNP | C35H43N7O11 | 159857-81-5 | Details |
| IKKγ NBD Inhibitory Peptide | 372146-18-4 | Details |
| Xenopsin-Related Peptide 1 (XP-1) | C51H79N15O9 | 117442-28-1 | Details |
| UFP-101 | C82H138N32O21 | 849024-68-6 | Details |
| Atriopeptin II (rat, rabbit, mouse) | C141H227N51O42S2 | 98084-69-6 | Details |
| ScyliorhininII | C77H119N21O26S3 | 112748-19-3 | Details |
| Pyr5]-Substance P (5-11) | C41H57N9O9S | 56104-22-4 | Details |
| Val-Asp-(Arg8)-Vasopressin | C55H78N16O17S2 | 100930-18-5 | Details |
| Pro9] Substance P | C66H102N18O13S | 104486-69-3 | Details |
| HIF-1 {alpha} (556-574) | C101H152N20O34S2 | 1201633-99-9 | Details |
| D-Trp34]-Neuropeptide Y | C196H289N55O56 | 153549-84-9 | Details |
| Nphe1]Nociceptin(1-13)NH2 | C61H100N22O15 | 267234-08-2 | Details |
| Tyr6,D-Phe7,D-His9]-Substance P (6-11) | C44H57N9O7S | 145194-26-9 | Details |
| Neuropeptide Y (2-36), amide, porcine | 102961-52-4 | Details |
| Neuropeptide S (Mouse) | C93H156N34O27 | 412938-74-0 | Details |
| D-Ala2,DMet5] Enkephalin | C28H37N5O7S | 100929-50-8 | Details |
| Pancreatic Polypeptide (rana temporaria) | C192H276N52O58 | 132187-74-7 | Details |
| Pancreatic Polypeptide (31-36) (free acid) (human) | C36H60N12O9 | 192432-73-8 | Details |
| Hypertrehalosaemic Neuropeptide, Nauphoeta cinerea | C50H67N13O14 | 106018-36-4 | Details |
| D-Phe7]-Bradykinin | C54H75N15O11 | 97825-00-8 | Details |
| Adamax | Details |
| Product Total: Product Page: | ||||
| 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 | ||||
