Changsha MOL Changes Biotechnology Co., Ltd.

Changsha MOL Changes Biotechnology Co., Ltd.

Main products: Peptide synthesis,Peptide modification,Protein and peptide labeling,Cellular response

Current Location: HOME >> Product
Product Categories
Changsha MOL Changes Biotechnology Co., Ltd.
Country: China
Tel:
Mobile: 19375158599
E-mail: info@molchanges.com
QQ:
Skype: Chat Now!
Address: Changsha Longping Bio-Industrial Park Provincial Research Center Factory
MOL Changes has unique technical capabilities in peptide synthesis, peptide modification, protein and peptide labeling, and cellular reactions. The company's technical staff comes from the fields of organic chemistry and biology, and the technical leadership consists of graduate students and PhDs. The company has mastered a wide range of peptide synthesis methods, including solid-phase peptide synthesis, liquid-phase peptide synthesis, combined liquid-solid peptide synthesis, reverse solid-phase peptide synthesis and microbial fermentation methods. microbial fermentation methods. We offer a wide range of synthetic R&D services for drug discovery, biological research and bioengineering, and provide scientists with viable pathways in the process of new drug development. The value of peptide synthesis we provide goes beyond long sequences and high purity, as we have unique techniques for solving complex and difficult peptide sequences, overcoming compatibility issues during peptide synthesis, and assisting our clients with a comprehensive optimization strategy for the research process. Our R&D, synthesis, purification, lyophilization, and testing are all done in sterile laboratories. Currently, we have set up research laboratories and branch offices in Changsha, Zhuzhou, and Hong Kong, and our customers are mainly from the United States, Canada, Russia, the United Kingdom, Australia, Sweden, Norway, and South Korea, which include biochemistry colleges, biochemical research institutes, medical research institutes, and bio-scientists. In the future, MOL Changes will continue to focus on technology research and development, with the aim of becoming a leading company in the field of single peptide products, and establishing a strong technological and cost advantage in the field, which will help our customers to occupy a dominant position in the market.
Product Name MF CAS Details
Aurein2.4 C77H133N19O19 Details
aurein 3.1 Details
SDV-Exendin-3/4 Details
AZP-531 C40H63N15O13 1088543-62-7 Details
Aurein Details
abaecin 123997-18-2 Details
aurein 4.1 Details
FMRF-like Neuropeptide C59H86N16O14 121801-61-4 Details
D-Ala2] Met-Enkephalin C28H37N5O7S 61370-87-4 Details
MARKSubstrate C60H108N18O21 847991-34-8 Details
TAK-448 C64H90F3N17O16 1433222-47-9 Details
Gramicidin S C60H92N12O10 113-73-5 Details
ADP355 peptide Details
Lys-(Hyp3)-Bradykinin C56H85N17O13 113662-39-8 Details
Guangxitoxin 1E C178H248N44O45S7 1233152-82-3 Details
Adipokinetic Hormone (AKH) (24-32), locust C44H60N10O12 53027-55-7 Details
Met-Enkephalin, amide C27H36N6O6S 60117-17-1 Details
CAP18 (rabbit) 152742-15-9 Details
D-Arg0,Hyp2,3,D-Phe7]-Bradykinin C60H87N19O14 111929-26-1 Details
Neuropeptide K, porcine C175H284N52O52S 106441-70-7 Details
Pancreastatin, porcine C214H330N68O76S 106477-83-2 Details
IFN-αReceptorRecognitionPeptide1 C35H59N13O12S 153840-64-3 Details
D-Trp32]-Neuropeptide Y (porcine) 178861-83-1 Details
Allatostatin VI C61H94N18O16 123209-95-0 Details
β-Amyloid (12-20) C57H83N15O11 134649-29-9 Details
β-Amyloid (13-27) C84H126N24O24 148270-13-7 Details
β-Amyloid (1-34) 186359-65-9 Details
β-Amyloid (10-35), amide C133H205N35O36S 181427-66-7 Details
β-Amyloid (11-22) C70H102N18O18 885323-98-8 Details
A20FMDV2 C93H163N31O28 932699-03-1 Details
H-γ-Glu-Abu-Gly-OH Details
Taspoglutide C152H232N40O45 275371-94-3 Details
C-Reactive Protein (CRP) 174-185 C62H93N13O16 160369-86-8 Details
NoxA1ds C50H88N14O15 1435893-78-9 Details
Ala113]-MBP (104-118) C67H104N20O19 99026-78-5 Details
SEB Domain (144-153) C50H90N14O17 210229-94-0 Details
DPCAJ1951 C76H127N23O19 943519-33-3 Details
RAGE antagonist C57H101N13O17S 1092460-91-7 Details
Ala107]-MBP (104-118) C67H104N20O19 99026-77-4 Details
RVD-Hpα C65H105N19O17 1193362-76-3 Details
Angstrom6/A6 Peptide C39H62N10O15 220334-14-5 Details
Big Gastrin I Human C176H251N43O53S1 60675-77-6 Details
ELA-11(human) C58H90N16O13S2 1784687-32-6 Details
Acetyl Pentapeptide-1 C32H51N9O10 97530-32-0 Details
[D-Trp7,9,10]-Substance P C79H105N21O13S 89430-38-6 Details
OrphaninFQ(1-11) C49H75N15O14 178249-41-7 Details
AUNP-12 C142H226N40O48 1353563-85-5 Details
Apidaecin IB C95H150N32O23 123276-94-8 Details
TAT (48-57) C55H109N31O12 253141-50-3 Details
AT-1002 C32H53N9O7S 835872-35-0 Details
Acein C43H68N10O13 Details
[(pF)Phe4]Nociceptin(1-13)NH2 C61H99FN22O15 380620-88-2 Details
Balixafortide C84H118N24O21S2 1051366-32-5 Details
Dynorphin B (1-13) C74H115N21O17 85006-82-2 Details
ADH-1 C22H34N8O6S2 229971-81-7 Details
Goralatide C20H33N5O9 127103-11-1 Details
Reltecimod C46H72N10O15S 1447799-33-8 Details
MLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLL 122304-04-5 Details
Basifungin C60H92N8O11 127785-64-2 Details
TT 232 C45H58N10O9S2 147159-51-1 Details
Edratide C111H149N27O28 433922-67-9 Details
P-113 C71H110N28O13 190673-58-6 Details
Big Endothelin-1 Fragment (22-38) (human) C80H125N23O25 124932-61-2 Details
AD 01 C115H187N33O42 959961-23-0 Details
Lys4] Sarafotoxin S6c C103H151N27O37S5 116495-45-5 Details
Big Endothelin -1 (1-39), porcine C192H287N49O58S5 124834-83-9 Details
Tyr-Uroguanylin (rat) C69H109N17O27S4 Details
Peptide T C35H55N9O16 106362-32-7 Details
Calcitonin Gene Related Peptide, chicken 104364-57-0 Details
hIRBP651-670 Details
Enterostatin C21H36N8O6 117830-79-2 Details
Substance P (1-4) C22H40N8O5 57468-16-3 Details
11R-VIVIT C147H259N67O36S 592517-80-1 Details
CyclicMKEY C113H174N28O34S2 934385-55-4 Details
Substance P (3-11)/Nona-Substance P C52H79N13O11S 51165-11-8 Details
Sar9] Substance P C64H100N18O13S 77128-75-7 Details
LY2510924 C62H88N14O10 1088715-84-7 Details
D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14) C44H64N14O10S2 349657-39-2 Details
Substance P (9-11) C13H26N4O3S 4652-64-6 Details
MC-Val-Cit-PABC-PNP C35H43N7O11 159857-81-5 Details
IKKγ NBD Inhibitory Peptide 372146-18-4 Details
Xenopsin-Related Peptide 1 (XP-1) C51H79N15O9 117442-28-1 Details
UFP-101 C82H138N32O21 849024-68-6 Details
Atriopeptin II (rat, rabbit, mouse) C141H227N51O42S2 98084-69-6 Details
ScyliorhininII C77H119N21O26S3 112748-19-3 Details
Pyr5]-Substance P (5-11) C41H57N9O9S 56104-22-4 Details
Val-Asp-(Arg8)-Vasopressin C55H78N16O17S2 100930-18-5 Details
Pro9] Substance P C66H102N18O13S 104486-69-3 Details
HIF-1 {alpha} (556-574) C101H152N20O34S2 1201633-99-9 Details
D-Trp34]-Neuropeptide Y C196H289N55O56 153549-84-9 Details
Nphe1]Nociceptin(1-13)NH2 C61H100N22O15 267234-08-2 Details
Tyr6,D-Phe7,D-His9]-Substance P (6-11) C44H57N9O7S 145194-26-9 Details
Neuropeptide Y (2-36), amide, porcine 102961-52-4 Details
Neuropeptide S (Mouse) C93H156N34O27 412938-74-0 Details
D-Ala2,DMet5] Enkephalin C28H37N5O7S 100929-50-8 Details
Pancreatic Polypeptide (rana temporaria) C192H276N52O58 132187-74-7 Details
Pancreatic Polypeptide (31-36) (free acid) (human) C36H60N12O9 192432-73-8 Details
Hypertrehalosaemic Neuropeptide, Nauphoeta cinerea C50H67N13O14 106018-36-4 Details
D-Phe7]-Bradykinin C54H75N15O11 97825-00-8 Details
Adamax Details
Product Total: Product Page:
12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53