LL-37

LL-37 Struktur
154947-66-7
CAS-Nr.
154947-66-7
Englisch Name:
LL-37
Synonyma:
II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 human acetate;Cathelicidin LL 37 (human);LL-37 (trifluoroacetate salt);Antibacterial Protein LL-37 (human);[LL-37, 37 aa];Antibacterial Protein LL-37 (huMan), LL37, CAMP;Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37
CBNumber:
CB02603131
Summenformel:
C205H340N60O53
Molgewicht:
0
MOL-Datei:
Mol file

LL-37 Eigenschaften

Löslichkeit
Water: 1 mg/ml
Aggregatzustand
A lyophilized powder
Wasserlöslichkeit
Soluble to 1 mg/ml in water
InChIKey
POIUWJQBRNEFGX-XAMSXPGMSA-N

Sicherheit

LL-37 Chemische Eigenschaften,Einsatz,Produktion Methoden

Beschreibung

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Verwenden

L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.

benefits

LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity.  Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.

Biologische Aktivität

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Nebenwirkungen

LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes

Einzelnachweise

[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

LL-37 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


LL-37 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 110)Lieferanten
Firmenname Telefon E-Mail Land Produktkatalog Edge Rate
Shanghai Affida new material science and technology center
+undefined15081010295
admin@oudaxin.com China 399 58
Sichuan Tai Hui Biotechnology Co., Ltd
+86-18224031330 +86-18081096520
404435307@qq.com China 25 58
Hebei Weimiao Import and Export Trade Co., Ltd.
+undefined19948166995
sale01@hbweimiao.com China 73 58
hebei hongtan Biotechnology Co., Ltd
+86-86-1913198-3935 +8617331935328
sales03@chemcn.cn China 971 58
CONTIDE BIOTECH CO.,LTD
+852-53358525
xena@healthtide-api.com China 619 58
Shanghai Getian Industrial Co., LTD
+86-15373193816 +86-15373193816
mike@ge-tian.com China 274 58
Hebei Anlijie Biotechnology Co., Ltd
+8619031013551
ably@aljbio.com China 196 58
Strong peptide cross-border e-commerce Co. LTD
+undefined13930052870
qt01@qiangtaipharm.com China 81 58
Dorne Chemical Technology co. LTD
+86-13583358881 +86-18560316533
Ethan@dornechem.com China 300 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551
asdf@shanghaihg.cn China 265 58

  • Antibacterial Protein LL-37 (huMan), LL37, CAMP
  • H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
  • Antibacterial Protein LL-37 (human)
  • LL-37 (trifluoroacetate salt)
  • [LL-37, 37 aa]
  • Cathelicidin LL 37 (human)
  • LL-37, LL37, CAMP
  • LL-37 human acetate
  • Cathelicidin LL-37
  • Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37
  • II37 Peptide
  • 154947-66-7
  • C205H340N60O53
Copyright 2019 © ChemicalBook. All rights reserved