CJC1295
|
|
- CAS-Nr.
- 863288-34-0
- Englisch Name:
- CJC1295
- Synonyma:
- CJC-1295 Acetate;CJC1295;CJC-1295(2MG);sarms CJC1295;CJC-1295(10mg);CJC 1295 w/o DAC;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC1295 No DAC acetate;CJC-1295 Acetate without DAC
- CBNumber:
- CB01470921
- Summenformel:
- C152H252N44O42
- Molgewicht:
- 3367.89688
- MOL-Datei:
- 863288-34-0.mol
|
CJC1295 Eigenschaften
- Schmelzpunkt:
- > 177° C (dec.)
- Dichte
- 1.45
- storage temp.
- -20°C Freezer, Under inert atmosphere
- Löslichkeit
- Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
- Aggregatzustand
- Solid
- Farbe
- White to Off-White
- InChIKey
- XOZMWINMZMMOBR-HRDSVTNWSA-N
Sicherheit
- Risiko- und Sicherheitserklärung
- Gefahreninformationscode (GHS)
Bildanzeige (GHS) |
|
Alarmwort |
Achtung |
Gefahrenhinweise |
Code |
Gefahrenhinweise |
Gefahrenklasse |
Abteilung |
Alarmwort |
Symbol |
P-Code |
H314 |
Verursacht schwere Verätzungen der Haut und schwere Augenschäden. |
Ätzwirkung auf die Haut |
Kategorie 1B |
Achtung |
src="/GHS05.jpg" width="20" height="20" /> |
P260,P264, P280, P301+P330+ P331,P303+P361+P353, P363, P304+P340,P310, P321, P305+ P351+P338, P405,P501 |
H318 |
Verursacht schwere Augenschäden. |
Schwere Augenschädigung |
Kategorie 1 |
Achtung |
src="/GHS05.jpg" width="20" height="20" /> |
P280, P305+P351+P338, P310 |
|
Sicherheit |
P280 |
Schutzhandschuhe/Schutzkleidung/Augenschutz tragen. |
P301+P330+P331 |
BEI VERSCHLUCKEN: Mund ausspülen. KEIN Erbrechen herbeiführen. |
P302+P352 |
BEI BERÜHRUNG MIT DER HAUT: Mit viel Wasser/... (Hersteller kann, falls zweckmäßig, ein Reinigungsmittel angeben oder, wenn Wasser eindeutig ungeeignet ist, ein alternatives Mittel empfehlen) waschen. |
P304+P340 |
BEI EINATMEN: Die Person an die frische Luft bringen und für ungehinderte Atmung sorgen. |
P305+P351+P338 |
BEI KONTAKT MIT DEN AUGEN: Einige Minuten lang behutsam mit Wasser spülen. Eventuell vorhandene Kontaktlinsen nach Möglichkeit entfernen. Weiter spülen. |
P310 |
Sofort GIFTINFORMATIONSZENTRUM/Arzt/ anrufen. |
|
CJC1295 Chemische Eigenschaften,Einsatz,Produktion Methoden
Beschreibung
CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.
Verwenden
CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.
Pharmakologie
By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.
Clinical Use
CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.
Nebenwirkungen
CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.
CJC1295 Upstream-Materialien And Downstream Produkte
Upstream-Materialien
Downstream Produkte
CJC1295 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.
Global( 157)Lieferanten
Firmenname |
Telefon |
E-Mail |
Land |
Produktkatalog |
Edge Rate |
Hebei Xunou new energy Technology Co., LTD
|
+undefined17531957005
|
xunou8@hbxunou.com |
China |
36 |
58 |
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
|
+8618068519287
|
sales@xuanmingchem.com |
China |
822 |
58 |
Zhuzhou Yaozhijie Chemical Co., LTD
|
+8618073316972
|
sales@goodpeptides.com |
China |
244 |
58 |
Wuhan Godbullraw Chemical Co.,ltd
|
+undefined18986288449
|
Alisasales@godbullraw.com |
China |
560 |
58 |
Hebei Nafu Technology Co. , Ltd.
|
+8615075022224
|
17745771666@hebeinafu.com |
China |
325 |
58 |
Hubei Lange Biotechnology Co., Ltd.
|
+8617762501948
|
sales2@langebiotech.com |
China |
154 |
58 |
Hebei Yinsheng Technology Co., Ltd.
|
+86-17331136691
|
lemon@hbyinsheng.com |
China |
622 |
58 |
Hebei Gongyuan New Material Technology Co., Ltd.
|
+8617331136198
|
Grace@hebeisyjl.com |
China |
497 |
58 |
Wuhan Cell Pharmaceutical Co., Ltd
|
+86-13129979210 +86-13129979210
|
sales@cellwh.com |
China |
376 |
58 |
Hebei Mojin Biotechnology Co., Ltd
|
+8613288715578
|
sales@hbmojin.com |
China |
12456 |
58 |
863288-34-0()Verwandte Suche:
- CJC1295
- Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
- L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
- CJC-1295 CJC-1295
- CJC1295 with out DAC
- -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
- CJC-1295(2MG)
- CJC-1295(10mg)
- CJC-1295 Without DAC 86328-34-0
- CJC-1295 Acetate without DAC
- Peptides Bodybuilding cjc-1295
- Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials
- CJC1295 No DAC acetate
- CJC 1295 w/o DAC
- CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG
- CJC-1295 Acetate
- sarms CJC1295
- 863288-34-0
- 156-1-5
- 86328-34-0
- C159H258N46O45
- Peptides
- CJC
- 863288-34-0