ChemicalBook >> CAS DataBase List >>GIP (HUMAN)

GIP (HUMAN)

CAS No.
100040-31-1
Chemical Name:
GIP (HUMAN)
Synonyms
GIP;GIP (HUMAN);GIP (Total);GIP (active);M.W. 4983.59 C226H338N60O66S;GASTRIC INHIBITORY PEPTIDE HUMAN;GASTRIC INHIBITORY POLYPEPTIDE (HUMAN);YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;Gastric inhibitorypolypeptide (human) (9CI);Gastric inhibitory polypeptide human, ≥95% (HPLC)
CBNumber:
CB3381115
Molecular Formula:
C226H338N60O66S
Molecular Weight:
4983.52932
MDL Number:
MFCD00081634
MOL File:
100040-31-1.mol
Last updated:2024-03-27 11:49:37

GIP (HUMAN) Properties

storage temp. −20°C
form Solid
Water Solubility Soluble to 1 mg/ml in water
Sequence H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
FDA UNII 1O4H75S7H2

SAFETY

Risk and Safety Statements

WGK Germany  3

GIP (HUMAN) price More Price(8)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich G2269 Gastric Inhibitory Polypeptide human ≥95% (HPLC) 100040-31-1 0.1mg $404 2024-03-01 Buy
Sigma-Aldrich G2269 Gastric Inhibitory Polypeptide human ≥95% (HPLC) 100040-31-1 0.5mg $1620 2024-03-01 Buy
Sigma-Aldrich G2269 Gastric Inhibitory Polypeptide human ≥95% (HPLC) 100040-31-1 .1mg $358 2022-05-15 Buy
Sigma-Aldrich G2269 Gastric Inhibitory Polypeptide human ≥95% (HPLC) 100040-31-1 .5mg $1440 2022-05-15 Buy
Alfa Aesar J66667 Gastric Inhibitory Peptide, human 100040-31-1 0.5mg $135 2021-12-16 Buy
Product number Packaging Price Buy
G2269 0.1mg $404 Buy
G2269 0.5mg $1620 Buy
G2269 .1mg $358 Buy
G2269 .5mg $1440 Buy
J66667 0.5mg $135 Buy

GIP (HUMAN) Chemical Properties,Uses,Production

Description

GIP was originally isolated as a gastric inhibitory polypeptide. After the discovery of its glucose-dependent insulinotropic activity, known as the incretin effect, GIP was renamed glucose-dependent insulinotropic peptide.
Gastric inhibitory peptide
Abbreviation: GIP
Additional names: gastric inhibitory polypeptide,gastrointestinal inhibitory peptide, glucose-dependent, insulinotropic peptide

Chemical Properties

Human GIP: Mr 4983.6, theoretical pI 6.92. GIP is soluble in water, but insoluble in ethanol. GIP is inactivated by DPP-4.

History

GIP was originally isolated from the porcine intestinal extract on the basis of its acid inhibitory activity in dogs (gastric inhibitory polypeptide) in the early 1970s, and subsequently renamed glucose-dependent insulinotropic peptide after the finding of its physiologically important role as a potentiator of glucose-stimulated insulin secretion.

Uses

GIP possessing incretin activity enhances glucosestimulated insulin release. GIP agonists are potentially useful for the treatment of diabetes. Moreover, DPP-4 inhibitors are approved for use in diabetes patients because GIP is rapidly deactivated by DPP-4.

Biosynthesis

The expression of GIP is regulated by nutrients. The administration of glucose and lipid into the rat gastrointestinal tract increases GIP mRNA levels. Circulating GIP levels are low in the fasted state and increase within minutes of food ingestion. The postprandial levels of circulating GIP are dependent on meal size. The degree to which nutrients regulate GIP secretion is speciesdependent. Fat is a more potent stimulator than carbohydrates in humans, whereas in the rodent and pig, carbohydrates are more potent than fat. Once released, GIP is rapidly deactivated by DPP-4.

Receptors

Structure and subtype
The receptor of GIP is a seven-transmembrane GPCR that belongs to a subclass of the family B. Both the relatively long extracellular N-terminal domain and the first transmembrane domain are important for ligand binding and receptor activation. The C-terminal cytoplasmic domain of the receptor is important for receptor desensitization and internalization. Like their peptide ligands, the GIP receptor and the GLP-1 receptor exhibit high degrees of amino acid sequence identity, with similar molecular structures and signaling processes. However, GIP does not bind to the GLP-1 receptor and vice versa.
Signal transduction pathway
Ligand binding to the GIP receptor primarily activates adenylyl cyclase and increases intracellular cAMP.6 The activation of the MAP kinase pathway, the phospholipase A2 pathway, and the phosphatidylinositol 3-kinase/protein kinase B pathway have also been reported.
Agonist
[D-Ala2]-GIP is an agonist. Tirzepatide (LY3298176) is a dual agonist of GIP and GLP-1 receptors.
Antagonists
GIP(6–30), ANTGIP (GIP-(7–30)-NH2) (a truncated GIP peptide antagonist), GIP(3–30)NH2 (a truncated GIP peptide antagonist), and [Pro3]-GIP; Exendin(9–39) amide are antagonists.

storage

Store at -20°C

Structure and conformation

Human GIP is a single 42-aa peptide. The structure of vertebrate GIP is well conserved and both the N-terminal and central regions are important for biological activity because truncated forms of GIP, GIP(1–39), and GIP (1–30) show a high degree of biological activity.2 The N-terminal two aa residues are cleaved off by dipeptidyl-peptidase 4 (DPP-4) in the circulation to form GIP(3–42), which has no insulinotropic activity.

GIP (HUMAN) Preparation Products And Raw materials

Raw materials

Preparation Products

GIP (HUMAN) Suppliers

Global( 105)Suppliers
Supplier Tel Email Country ProdList Advantage
Wuhan senwayer century chemical Co.,Ltd
+undefined-27-86652399 +undefined13627115097 market02@senwayer.com China 875 58
Alpha Biopharmaceuticals Co., Ltd
+86-411-39042497 +8613921981412 sales@alphabiopharm.com China 886 58
Shenzhen Nexconn Pharmatechs Ltd
+86-755-89396905 +86-15013857715 admin@nexconn.com China 10248 58
BOC Sciences
+1-631-485-4226 inquiry@bocsci.com United States 19553 58
Shanghai Longyu Biotechnology Co., Ltd.
+8615821988213 info@longyupharma.com China 2531 58
Cellmano Biotech Limited
0551-65326643 18156095617 info@cellmano.com China 999 58
career henan chemical co
+86-0371-86658258 15093356674; factory@coreychem.com China 29826 58
Zhejiang J&C Biological Technology Co.,Limited
+1-2135480471 +1-2135480471 sales@sarms4muscle.com China 10523 58
Hangzhou Go Top Peptide Biotech
0571-88211921 sales1@gotopbio.com CHINA 2609 58
Alfa Chemistry
+1-5166625404 Info@alfa-chemistry.com United States 21317 58

View Lastest Price from GIP (HUMAN) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
 GIP (HUMAN)  pictures 2023-11-27 GIP (HUMAN)
100040-31-1
US $0.00 / MG 1MG 98% 20 TONS Wuhan Senwayer Century Chemical Co.,Ltd
 GIP (HUMAN) pictures 2020-02-12 GIP (HUMAN)
100040-31-1
US $7.00 / KG 1KG 99% 100KG Career Henan Chemical Co
  •  GIP (HUMAN)  pictures
  • GIP (HUMAN)
    100040-31-1
  • US $0.00 / MG
  • 98%
  • Wuhan Senwayer Century Chemical Co.,Ltd
  •  GIP (HUMAN) pictures
  • GIP (HUMAN)
    100040-31-1
  • US $7.00 / KG
  • 99%
  • Career Henan Chemical Co
H-TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN-OH GLUCOSE-DEPENDENT INSULINOTROPIC POLYPEPTIDE (HUMAN) GASTRIC INHIBITORY PEPTIDE HUMAN GASTRIC INHIBITORY POLYPEPTIDE (HUMAN) GIP (HUMAN) GIP YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-HIS-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS-GLY-LYS-LYS-ASN-ASP-TRP-LYS-HIS-ASN-ILE-THR-GLN Gastric Inhibitory Polypeptide (huMan) GIP (huMan), Glucose-Dependent Insulinotropic Polypeptide (huMan) GIP (huMan), Glucose-Dependent Insulinotropic Polypeptide (huMan) GIP, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln M.W. 4983.59 C226H338N60O66S REF DUPL: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH Gastric inhibitorypolypeptide (human) (9CI) Gastric Inhibitory Polypeptide huManGastric Inhibitory Polypepti Gastric inhibitory polypeptide human, ≥95% (HPLC) GIP (active) GIP (Total) 100040-31-1 C226H338N60O66S Gastrointestinal Products Gastric Inhibitory Polypeptides Peptides Biochemicals and Reagents BioChemical Amino Acids and Peptides peptide Glucagon receptor and related