| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:GLP-1/Glucagon-Like Peptide, human
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
|
| | GLP-1/Glucagon-Like Peptide, human Basic information |
| Product Name: | GLP-1/Glucagon-Like Peptide, human | | Synonyms: | GLP-1/Glucagon-Like Peptide, human;HIS-ASP-GLU-PHE-GLU-ARG-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![GLP-1/Glucagon-Like Peptide, human Structure]() |
| | GLP-1/Glucagon-Like Peptide, human Chemical Properties |
| | GLP-1/Glucagon-Like Peptide, human Usage And Synthesis |
| | GLP-1/Glucagon-Like Peptide, human Preparation Products And Raw materials |
|