134875-67-5

Directory

134875-67-5 Structure

Identification	Back Directory
[Name] GASTRIC INHIBITORY POLYPEPTIDE (1-30), PORCINE
[CAS] 134875-67-5
[Synonyms] GASTRIC INHIBITORY POLYPEPTIDE (1-30), PORCINE TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-ARG-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS TYR-ALA-GLU-GLY-THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-LYS-ILE-ARG-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-LYS: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK
[MDL Number] MFCD00166825

Hazard Information	Back Directory
[Uses] Gastric Inhibitory Polypeptide (1-30), porcine lacks the C-terminal 12 amino acid residues of natural gastric inhibitory polypeptide (GIP), exhibits biologic activity by potentiating the release of insulin and somatostatin[1].
[References] [1] Krarup T, et al. Effect of porcine gastric inhibitory polypeptide on beta-cell function in type I and type II diabetes mellitus. Metabolism. 1987 Jul;36(7):677-82. DOI:10.1016/0026-0495(87)90153-3 [2] G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74.

134875-67-5 suppliers list

Company Name:	Hangzhou Go Top Peptide Biotech
Tel:	0571-88211921
Website:	http://www.gotopbio.com/

Company Name:	Wuxi Zhongkun Biochemical Technology Co., Ltd.
Tel:	0510-85629785 18013409632
Website:	www.reading-chemicals.com

Company Name:	Hangzhou Peptidego Biotech Co.,Ltd.
Tel:	0571-87213919
Website:	http://peptidego.com

Company Name:	Nanjing Meihao Pharmaceutical Technology Co., Ltd.
Tel:	meitaochem@126.com
Website:	www.chemicalbook.com/ShowSupplierProductsList31244/0_EN.htm

Company Name:	Wuxi Helen Biotechnology Co., Ltd.,
Tel:	0510-85629785 18013409632
Website:	http://www.reading-chemicals.com

Company Name:	Nanjing Shizhou Biology Technology Co.,Ltd
Tel:	13675144456
Website:	www.synzest.com

Company Name:	Nanjing Yuanpeptide Biotech Co.，Ltd.
Tel:	18168071971
Website:	http://www.yuan-peptide.com

Company Name:	Shaoxing Junyu Biotechnology Co., LTD
Tel:	0571-0571-88211921 19105816207
Website:	www.gotopbio.com/

Company Name:	Hangzhou Sinoda Pharmaceutical Technology Co. LTD
Tel:	0571-87213919 17306812703
Website:	www.chemicalbook.com/ShowSupplierProductsList1355681/0_EN.htm

Company Name:	Hangzhou Beiputai Biopharmaceutical Co., Ltd
Tel:	0571-85350119 15888826472
Website:	http://www.beiputaibio.com/

Company Name:	Nantong Hanfang Biotechnology Co. , Ltd.
Tel:	hanfangpharma@126.com; 18616537568
Website:	https://hanfangpharma@126.com

Company Name:	Biosynth Biological Technology (Suzhou) Co Ltd
Tel:	51288865780
Website:	www.biosynth.com

Tags:134875-67-5 Related Product Information

HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

Login