ChemicalBook
Chinese english Germany Japanese Korea

VIP Produkt Beschreibung

VIP Struktur
40077-57-4
CAS-Nr.
40077-57-4
Englisch Name:
VIP
Synonyma:
VIP;VIP【pig】;aviptidal;AVIPTADIL;VIP PORCINE;VIP【rabbit】;Aviptadil Acetate;Metformin glycinate;UROTENSIN-II, MOUSE;VIP (HUMAN, PORCINE)
CBNumber:
CB9215069
Summenformel:
C147H238N44O42S
Molgewicht:
3325.8
MOL-Datei:
40077-57-4.mol

VIP Eigenschaften

storage temp. 
−20°C
Löslichkeit
1% acetic acid: soluble 0.1%, clear, colorless
Aggregatzustand
powder

Sicherheit

WGK Germany  3

VIP Chemische Eigenschaften,Einsatz,Produktion Methoden

Verwenden

Pulmonary hypertension;Erectile dysfunction

Allgemeine Beschreibung

Vasoactive intestinal peptide (VIP) is widely distributed inthe body and is believed to occur throughout the gastrointestinaltract. It is a 28-residue polypeptide with structuralsimilarities to secretin and glucagon. It causes vasodilatationand increases cardiac contractibility. VIP stimulates bicarbonatesecretion, relaxes gastrointestinal and othersmooth muscles, stimulates glycogenesis, inhibits gastricacid secretion, and stimulates insulin secretion. Its hormonaland neurotransmitter role has been investigated.

VIP Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


VIP Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 119)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
Shenzhen Sendi Biotechnology Co.Ltd.
0755-23311925 18102838259
0755-23311925 Abel@chembj.com CHINA 3194 55
Henan DaKen Chemical CO.,LTD.
+86-371-55531817
info@dakenchem.com CHINA 21714 58
Henan Tianfu Chemical Co.,Ltd.
0371-55170693
0371-55170693 info@tianfuchem.com CHINA 20672 55
Nanjing Finetech Chemical Co., Ltd.
025-85710122 17714198479
025-85710122 sales@fine-chemtech.com CHINA 892 55
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30002 58
Chengdu Biopurify Phytochemicals Ltd.
18080483897
maggie@biopurify.com CHINA 2258 58
Haihang Industry Co.,Ltd
86-531-88032799
+86 531 8582 1093 export@haihangchem.com CHINA 8921 58
Shaanxi Pioneer Biotech Co., Ltd .
86-13259417953(Whatsapp)
029-84385017 sales@pioneerbiotech.com CHINA 3030 58

  • Aviptadil Acetate(VIP)
  • aviptidal
  • Vasoactive Intestinal Peptide, Human, Porcine, and Rat - CAS 40077-57-4 - Calbiochem
  • VASOACTIVE INTESTINAL PEPTIDE (HUMAN, BOVINE, PORCINE, RAT)
  • VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE)
  • VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, AND RAT
  • VASOACTIVE INTESTINAL PEPTIDE (HUMAN, PORCINE) (BOVINE, RAT, CANINE)
  • VASOACTIVE INTESTINAL PEPTIDE HUMAN, PORCINE, RAT
  • VASOACTIVE INTESTINAL PEPTIDE, HUMAN, PORCINE, RAT, OVINE
  • VASOACTIVE INTESTINAL PEPTIDE, PORCINE
  • VASOACTIVE INTESTINAL PEPTIDE
  • VIP, (HUMAN, PORCINE, RAT, OVINE)
  • VIP (HUMAN, RAT, MOUSE, RABBIT, CANINE, PORCINE)
  • VIP (HUMAN, BOVINE, PORCINE, RAT)
  • VIP (HUMAN, PORCINE)
  • VIP, HUMAN, PORCINE, AND RAT
  • VIP (HUMAN, PORCINE) (BOVINE, RAT, CANINE)
  • VIP, HUMAN, PORCINE, RAT
  • VIP PORCINE
  • VIP
  • Vasoactive Intestinal Peptide human, porcine, rat,VIP
  • VIP (huMan, Mouse, rat)
  • VIP (28 aMino acids)
  • Vasoactive Intestinal Peptide huMan, porcine, ratVasoactive Intestinal Peptide huM
  • Metformin glycinate
  • VIP, human, ovine, porcine, rat
  • AVIPTADIL
  • H-HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2
  • HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2
  • HIS-SER-ASP-ALA-VAL-PHE-THR-ASP-ASN-TYR-THR-ARG-LEU-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ASN-SER-ILE-LEU-ASN-NH2 HUMAN, PORCINE, RAT
  • HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
  • VIP (Vasoactive Intestinal peptide)
  • VIP(human,bovine,porcine,rat)Acetate
  • PROLACTIN-RELEASING PEPTIDE (1-310,*(PRR
  • PROLACTIN-RELEASING PEPTIDE (12-31),*(PR
  • UROTENSIN-II, MOUSE
  • PROLACTIN-RELEASING PEPTIDE (1-31),*(PRR
  • human,rat,mouse,rabbit,canine,porcine
  • vasoactive intestinal polypeptide
  • M.W. 3325.84 C147H238N44O42S
  • Vasoactive intestinal octacosapeptide
  • Vasoactive intestinal octacosapeptide【pig】
  • VIP【pig】
  • VIP【rabbit】
  • Aviptadil Acetate
  • VIP, human, porcine, rat: VIP (28 amino acids)
  • 40077-57-4
  • C147H238N44O42S
  • C147H238N44O42S1
  • CRF
  • Releasing Factors
  • Vasoactive Intestinal Peptides
  • Peptides
  • PrRP
  • BioChemical
  • Biochemicals and Reagents
  • Amino Acids and Peptides
  • 活性多肽片段
Copyright 2019 © ChemicalBook. All rights reserved