Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> AMYLOID BETA-PROTEIN (40-1)

AMYLOID BETA-PROTEIN (40-1)

AMYLOID BETA-PROTEIN (40-1) price.
  • $135 - $2500
  • Product name: AMYLOID BETA-PROTEIN (40-1)
  • CAS: 144409-99-4
  • MF: C194H295N53O58S
  • MW: 4329.8034
  • EINECS:
  • MDL Number:MFCD00213069
  • Synonyms:PEPTIDE WITH REVERSED SEQUENCE OF AMYLOID BETA-PROTEIN (HUMAN, 1-40) TRIFLUOROACETATE;VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD;VAL-VAL-GLY-GLY-VAL-MET-LEU-GLY-ILE-ILE-ALA-GLY-LYS-ASN-SER-GLY-VAL-ASP-GLU-ALA-PHE-PHE-VAL-LEU-LYS-GLN-HIS-HIS-VAL-GLU-TYR-GLY-SER-ASP-HIS-ARG-PHE-GLU-ALA-ASP TRIFLUOROACETATE;H-VAL-VAL-GLY-GLY-VAL-MET-LEU-GLY-ILE-ILE-ALA-GLY-LYS-ASN-SER-GLY-VAL-ASP-GLU-ALA-PHE-PHE-VAL-LEU-LYS-GLN-HIS-HIS-VAL-GLU-TYR-GLY-SER-ASP-HIS-ARG-PHE-GLU-ALA-ASP-OH;BETA-AMYLOID (40-1);Amyloid β-Protein (40-1);AMyloid b-Protein (40-1);AMYLOID BETA-PROTEIN (40-1)
14 prices
Selected condition:
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • Biosynth
  • Sigma-Aldrich
Package
  • 0.1mg
  • 500ug
  • 1000ug
  • 1mg
  • 2mg
  • 2000ug
  • 5000ug
  • 5mg
  • 10000ug
  • .5MG
  • 10mg
  • Manufactureraablocks
  • Product numberAA00AOGY
  • Product descriptionAMYLOID BETA-PROTEIN (40-1) ≥95%
  • Packaging1mg
  • Price$345
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPRO0000317
  • Product descriptionAMYLOID BETA-PROTEIN FRAGMENT(40-1) 95.00%
  • Packaging.5MG
  • Price$1030.26
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging10mg
  • Price$1408.7
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging5000ug
  • Price$1500
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging10000ug
  • Price$2500
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging2000ug
  • Price$740
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging1000ug
  • Price$420
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging500ug
  • Price$240
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging2mg
  • Price$405
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberPAB-4413-S
  • Product descriptionAmyloid Beta-Protein (40-1)
  • Packaging0.1mg
  • Price$427.2
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging5mg
  • Price$810
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging500ug
  • Price$135
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging1mg
  • Price$238
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberA2326
  • Product descriptionAmyloid β-Protein Fragment 40-1 ≥90% (HPLC)
  • Packaging0.1mg
  • Price$239
  • Updated2026-04-30
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA00AOGY AMYLOID BETA-PROTEIN (40-1) ≥95% 1mg $345 2026-05-28 Buy
American Custom Chemicals Corporation PRO0000317 AMYLOID BETA-PROTEIN FRAGMENT(40-1) 95.00% .5MG $1030.26 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 10mg $1408.7 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 5000ug $1500 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 10000ug $2500 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 2000ug $740 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 1000ug $420 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 500ug $240 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 2mg $405 2021-12-16 Buy
Biosynth PAB-4413-S Amyloid Beta-Protein (40-1) 0.1mg $427.2 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 5mg $810 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 500ug $135 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 1mg $238 2021-12-16 Buy
Sigma-Aldrich A2326 Amyloid β-Protein Fragment 40-1 ≥90% (HPLC) 0.1mg $239 2026-04-30 Buy

Properties

storage temp. :−20°C
form :powder
Sequence :H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH

Safety Information

Symbol(GHS): Exclamation Mark (GHS07)
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning P264, P270, P301+P312, P330, P501
H315 Causes skin irritation Skin corrosion/irritation Category 2 Warning P264, P280, P302+P352, P321,P332+P313, P362
H319 Causes serious eye irritation Serious eye damage/eye irritation Category 2A Warning P264, P280, P305+P351+P338,P337+P313P
H335 May cause respiratory irritation Specific target organ toxicity, single exposure;Respiratory tract irritation Category 3 Warning
Precautionary statements:
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P305+P351+P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continuerinsing.

Description


Related product price