Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> AMYLOID BETA-PROTEIN (40-1)

AMYLOID BETA-PROTEIN (40-1)

AMYLOID BETA-PROTEIN (40-1) price.
  • $238 - $2500
  • Product name: AMYLOID BETA-PROTEIN (40-1)
  • CAS: 144409-99-4
  • MF: C194H295N53O58S
  • MW: 4329.8034
  • EINECS:
  • MDL Number:MFCD00213069
  • Synonyms:PEPTIDE WITH REVERSED SEQUENCE OF AMYLOID BETA-PROTEIN (HUMAN, 1-40) TRIFLUOROACETATE;VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD;VAL-VAL-GLY-GLY-VAL-MET-LEU-GLY-ILE-ILE-ALA-GLY-LYS-ASN-SER-GLY-VAL-ASP-GLU-ALA-PHE-PHE-VAL-LEU-LYS-GLN-HIS-HIS-VAL-GLU-TYR-GLY-SER-ASP-HIS-ARG-PHE-GLU-ALA-ASP TRIFLUOROACETATE;H-VAL-VAL-GLY-GLY-VAL-MET-LEU-GLY-ILE-ILE-ALA-GLY-LYS-ASN-SER-GLY-VAL-ASP-GLU-ALA-PHE-PHE-VAL-LEU-LYS-GLN-HIS-HIS-VAL-GLU-TYR-GLY-SER-ASP-HIS-ARG-PHE-GLU-ALA-ASP-OH;BETA-AMYLOID (40-1);Amyloid β-Protein (40-1);AMyloid b-Protein (40-1);AMYLOID BETA-PROTEIN (40-1)
Price13 Properties Safety Information Description
13 prices
Selected condition：
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • Biosynth
  • Sigma-Aldrich
Package
  • 0.1mg
  • 500ug
  • 1mg
  • 1000ug
  • 2000ug
  • 5mg
  • 10000ug
  • .5MG
  • 2mg
  • 5000ug
  • 10mg
  • Manufactureraablocks
  • Product numberAA00AOGY
  • Product descriptionAMYLOID BETA-PROTEIN (40-1) ≥95%
  • Packaging1mg
  • Price$345
  • Updated2026-05-28
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPRO0000317
  • Product descriptionAMYLOID BETA-PROTEIN FRAGMENT(40-1) 95.00%
  • Packaging.5MG
  • Price$1030.26
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging10mg
  • Price$1408.7
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging5000ug
  • Price$1500
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging10000ug
  • Price$2500
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging2mg
  • Price$405
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging1000ug
  • Price$420
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberPAB-4413-S
  • Product descriptionAmyloid Beta-Protein (40-1)
  • Packaging0.1mg
  • Price$427.2
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging2000ug
  • Price$740
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging5mg
  • Price$810
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt
  • Packaging1mg
  • Price$238
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFA108830
  • Product descriptionAmyloid beta-Protein (40-1) trifluoroacetate salt
  • Packaging500ug
  • Price$240
  • Updated2026-06-04
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberA2326
  • Product descriptionAmyloid β-Protein Fragment 40-1 ≥90% (HPLC)
  • Packaging0.1mg
  • Price$239
  • Updated2026-04-30
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA00AOGY AMYLOID BETA-PROTEIN (40-1) ≥95% 1mg $345 2026-05-28 Buy
American Custom Chemicals Corporation PRO0000317 AMYLOID BETA-PROTEIN FRAGMENT(40-1) 95.00% .5MG $1030.26 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 10mg $1408.7 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 5000ug $1500 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 10000ug $2500 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 2mg $405 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 1000ug $420 2026-06-04 Buy
Biosynth PAB-4413-S Amyloid Beta-Protein (40-1) 0.1mg $427.2 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 2000ug $740 2026-06-04 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 5mg $810 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH trifluoroacetate salt 1mg $238 2021-12-16 Buy
Biosynth FA108830 Amyloid beta-Protein (40-1) trifluoroacetate salt 500ug $240 2026-06-04 Buy
Sigma-Aldrich A2326 Amyloid β-Protein Fragment 40-1 ≥90% (HPLC) 0.1mg $239 2026-04-30 Buy

Properties

storage temp. :−20°C
form :powder
Sequence :H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH

Safety Information

Symbol(GHS): Exclamation Mark (GHS07)
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning P264, P270, P301+P312, P330, P501
H315 Causes skin irritation Skin corrosion/irritation Category 2 Warning P264, P280, P302+P352, P321,P332+P313, P362
H319 Causes serious eye irritation Serious eye damage/eye irritation Category 2A Warning P264, P280, P305+P351+P338,P337+P313P
H335 May cause respiratory irritation Specific target organ toxicity, single exposure;Respiratory tract irritation Category 3 Warning
Precautionary statements:
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P305+P351+P338 IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continuerinsing.

Description

More related product prices

131438-74-9 AMYLOID BETA-PROTEIN (1-15) H-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-OH 144189-71-9 131580-10-4 H-ILE-ILE-GLY-LEU-MET-OH 190436-05-6 109770-29-8 BETA-AMYLOID (1-43) 147740-73-6 AMYLOID BETA-PROTEIN (1-40) (MOUSE, RAT) Ethyl isocyanoacetate Tosylmethyl isocyanide PHENYLSELENOL

Related product price

Suppliers and manufacturers

GL Biochem (Shanghai) Ltd Shanghai Hanhong Scientific Co.,Ltd. Chemsky (shanghai) International Co.,Ltd Cellmano Biotech Limited Nanjing Dulai Biotechnology Co., Ltd. Wuxi Zhongkun Biochemical Technology Co., Ltd. Shanghai Macklin Biochemical Co.,Ltd. Creative Peptides Shanghai YuanYe Biotechnology Co., Ltd. Nanjing Leon Biological Technology Co., Ltd.