Welcome to chemicalbook!
China English Japan Germany
010-86108875
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structure Search
RFQ
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
My chemicalbook Sign in

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook >> CAS DataBase List >> BNP-32 (PORCINE)

BNP-32 (PORCINE)

BNP-32 (PORCINE) price.
  • $165.73 - $2950
  • Product name: BNP-32 (PORCINE)
  • CAS: 117345-87-6
  • MF: C149H250N52O44S3
  • MW: 3570.1
  • EINECS:
  • MDL Number:MFCD00076242
  • Synonyms:Brain natriuretic factor 32【porcine】;L-Ser-L-Pro-L-Lys-L-Thr-L-Met-L-Arg-L-Asp-L-Ser-Gly-L-Cys(1)-L-Phe-Gly-L-Arg-L-Arg-L-Leu-L-Asp-L-Arg-L-Ile-Gly-L-Ser-L-Leu-L-Ser-Gly-L-Leu-Gly-L-Cys(1)-L-Asn-L-Val-L-Leu-L-Arg-L-Arg-L-Tyr-OH;pBNP-32;Porcine Brain Natriuretic Peptide-32;SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (DISULFIDE BRIDGE: 10-26);SER-PRO-LYS-THR-MET-ARG-ASP-SER-GLY-CYS-PHE-GLY-ARG-ARG-LEU-ASP-ARG-ILE-GLY-SER-LEU-SER-GLY-LEU-GLY-CYS-ASN-VAL-LEU-ARG-ARG-TYR;BRAIN (B-TYPE)NATRIURETIC PEPTIDE-32;H-SER-PRO-LYS-THR-MET-ARG-ASP-SER-GLY-CYS-PHE-GLY-ARG-ARG-LEU-ASP-ARG-ILE-GLY-SER-LEU-SER-GLY-LEU-GLY-CYS-ASN-VAL-LEU-ARG-ARG-TYR-OH
Price15 Properties Safety Information Description
15 prices
Selected condition：
Brand
  • aablocks
  • American Custom Chemicals Corporation
  • Biosynth
  • Thermo Scientific Chemicals
Package
  • 250ug
  • 500ug
  • 0.5mg
  • 1mg
  • 1000ug
  • 2mg
  • 2000ug
  • 2.5mg
  • 5000ug
  • 5mg
  • Manufactureraablocks
  • Product numberAA000E2U
  • Product descriptionL-Tyrosine, L-seryl-L-prolyl-L-lysyl-L-threonyl-L-methionyl-L-arginyl-L-α-aspartyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-arginyl-L-leucyl-L-α-aspartyl-L-arginyl-L-isoleucylglycyl-L-seryl-L-leucyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-, cyclic (10→26)-disulfide
  • Packaging2.5mg
  • Price$1138
  • Updated2026-05-25
  • Buy
  • Manufactureraablocks
  • Product numberAA000E2U
  • Product descriptionL-Tyrosine, L-seryl-L-prolyl-L-lysyl-L-threonyl-L-methionyl-L-arginyl-L-α-aspartyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-arginyl-L-leucyl-L-α-aspartyl-L-arginyl-L-isoleucylglycyl-L-seryl-L-leucyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-, cyclic (10→26)-disulfide
  • Packaging1mg
  • Price$688
  • Updated2026-05-25
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0000830
  • Product descriptionBNP-32, PORCINE 95.00%
  • Packaging1MG
  • Price$812.54
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging1000ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging250ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging500ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000504
  • Product descriptionBNP-32, porcine
  • Packaging0.5mg
  • Price$165.73
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberCRB1000504
  • Product descriptionBNP-32, porcine
  • Packaging1mg
  • Price$226.78
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging2mg
  • Price$757
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging1mg
  • Price$445
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging2000ug
  • Price$1360
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging5mg
  • Price$1645.65
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth
  • Product numberFB108820
  • Product descriptionBNP-32 (porcine) trifluoroacetate salt
  • Packaging5000ug
  • Price$2950
  • Updated2026-06-04
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ66536
  • Product descriptionBrain Natriuretic Peptide (1-32), porcine
  • Packaging1mg
  • Price$282
  • Updated2021-12-16
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ66536
  • Product descriptionBrain Natriuretic Peptide (1-32), porcine
  • Packaging0.5mg
  • Price$181
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA000E2U L-Tyrosine, L-seryl-L-prolyl-L-lysyl-L-threonyl-L-methionyl-L-arginyl-L-α-aspartyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-arginyl-L-leucyl-L-α-aspartyl-L-arginyl-L-isoleucylglycyl-L-seryl-L-leucyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-, cyclic (10→26)-disulfide 2.5mg $1138 2026-05-25 Buy
aablocks AA000E2U L-Tyrosine, L-seryl-L-prolyl-L-lysyl-L-threonyl-L-methionyl-L-arginyl-L-α-aspartyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-arginyl-L-leucyl-L-α-aspartyl-L-arginyl-L-isoleucylglycyl-L-seryl-L-leucyl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-asparaginyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-, cyclic (10→26)-disulfide 1mg $688 2026-05-25 Buy
American Custom Chemicals Corporation PEP0000830 BNP-32, PORCINE 95.00% 1MG $812.54 2021-12-16 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 1000ug $900 2026-06-04 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 250ug $900 2026-06-04 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 500ug $900 2026-06-04 Buy
Biosynth CRB1000504 BNP-32, porcine 0.5mg $165.73 2026-06-04 Buy
Biosynth CRB1000504 BNP-32, porcine 1mg $226.78 2026-06-04 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 2mg $757 2021-12-16 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 1mg $445 2021-12-16 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 2000ug $1360 2026-06-04 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 5mg $1645.65 2021-12-16 Buy
Biosynth FB108820 BNP-32 (porcine) trifluoroacetate salt 5000ug $2950 2026-06-04 Buy
Thermo Scientific Chemicals J66536 Brain Natriuretic Peptide (1-32), porcine 1mg $282 2021-12-16 Buy
Thermo Scientific Chemicals J66536 Brain Natriuretic Peptide (1-32), porcine 0.5mg $181 2021-12-16 Buy

Properties

storage temp. :−20°C
form :Solid

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

More related product prices

ANGIOTENSINOGEN

Related product price

Suppliers and manufacturers

GL Biochem (Shanghai) Ltd Shanghai Hanhong Scientific Co.,Ltd. Chemsky（shanghai）International Co.,Ltd. Cellmano Biotech Limited Wuxi Zhongkun Biochemical Technology Co., Ltd. Creative Peptides Nanjing Leon Biological Technology Co., Ltd. Nanjing Peptide Biotech Ltd. Chengdu Youngshe Chemical Co., Ltd. Hangzhou Peptidego Biotech Co.,Ltd.