CHARYBDOTOXIN
|
|
- $152 - $9193.6
- Product name: CHARYBDOTOXIN
- CAS: 95751-30-7
- MF: C176H277N57O55S7
- MW: 4295.89
- EINECS:
- MDL Number:MFCD00146378
- Synonyms:CHARYBDOTOXIN;CHARYBDOTOXIN, RECOMBINANT;CHARYBDOTOXIN, RECOMBINANT, E COLI;CHARYBDOTOXIN, LEIURUS QUINQUESTRIATUS HEBRAEUS;CHTX;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS;PYR-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (DISULFIDE BRIDGE: 7-28,13-33 AND 17-35);PYR-PHE-THR-ASN-VAL-SER-CYS-THR-THR-SER-LYS-GLN-CYS-TRP-SER-VAL-CYS-GLN-ARG-LEU-HIS-ASN-THR-SER-ARG-GLY-LYS-CYS-MET-ASN-LYS-LYS-CYS-ARG-CYS-TYR-SER-OH
33 prices
Selected condition:
Brand
- ApexBio Technology
- Arctom
- Biorbyt Ltd
- Biosynth
- ChemScene
- Sigma-Aldrich
- Thermo Scientific Chemicals
- TRC
- Usbiological
Package
- 10ug
- 50ug
- 100μg
- 100ug
- 0.1mg
- 250ug
- 250μg
- 500ug
- 500μg
- 1mg
- 1000ug
- 5mg
- 10mg
- 100microg
- ManufacturerApexBio Technology
- Product numberB6592
- Product descriptionCharybdotoxin
- Packaging10ug
- Price$282
- Updated2021-12-16
- Buy
- ManufacturerApexBio Technology
- Product numberB6592
- Product descriptionCharybdotoxin
- Packaging100ug
- Price$376
- Updated2026-05-06
- Buy
- ManufacturerArctom
- Product numberHY-P0191
- Product descriptionCharybdotoxin 95.10%
- Packaging500μg
- Price$434
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P0191
- Product descriptionCharybdotoxin 95.10%
- Packaging1mg
- Price$699
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P0191
- Product descriptionCharybdotoxin 95.10%
- Packaging100μg
- Price$196
- Updated2026-05-26
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372971
- Product descriptionCharybdotoxin > 95%
- Packaging5mg
- Price$6131.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372971
- Product descriptionCharybdotoxin > 95%
- Packaging10mg
- Price$9193.6
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372971
- Product descriptionCharybdotoxin > 95%
- Packaging1mg
- Price$2459.9
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin
- Packaging1000ug
- Price$3080
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
- Packaging1mg
- Price$1710
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin
- Packaging500ug
- Price$1770
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
- Packaging500ug
- Price$985
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin
- Packaging250ug
- Price$1017.5
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
- Packaging50ug
- Price$163
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin
- Packaging100ug
- Price$509
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFC110443
- Product descriptionCharybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35)
- Packaging100ug
- Price$283
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| ApexBio Technology | B6592 | Charybdotoxin | 10ug | $282 | 2021-12-16 | Buy |
| ApexBio Technology | B6592 | Charybdotoxin | 100ug | $376 | 2026-05-06 | Buy |
| Arctom | HY-P0191 | Charybdotoxin 95.10% | 500μg | $434 | 2026-05-26 | Buy |
| Arctom | HY-P0191 | Charybdotoxin 95.10% | 1mg | $699 | 2026-05-26 | Buy |
| Arctom | HY-P0191 | Charybdotoxin 95.10% | 100μg | $196 | 2026-05-26 | Buy |
| Biorbyt Ltd | orb372971 | Charybdotoxin > 95% | 5mg | $6131.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372971 | Charybdotoxin > 95% | 10mg | $9193.6 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb372971 | Charybdotoxin > 95% | 1mg | $2459.9 | 2021-12-16 | Buy |
| Biosynth | FC110443 | Charybdotoxin | 1000ug | $3080 | 2026-06-04 | Buy |
| Biosynth | FC110443 | Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) | 1mg | $1710 | 2021-12-16 | Buy |
| Biosynth | FC110443 | Charybdotoxin | 500ug | $1770 | 2026-06-04 | Buy |
| Biosynth | FC110443 | Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) | 500ug | $985 | 2021-12-16 | Buy |
| Biosynth | FC110443 | Charybdotoxin | 250ug | $1017.5 | 2026-06-04 | Buy |
| Biosynth | FC110443 | Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) | 50ug | $163 | 2021-12-16 | Buy |
| Biosynth | FC110443 | Charybdotoxin | 100ug | $509 | 2026-06-04 | Buy |
| Biosynth | FC110443 | Charybdotoxin Pyr-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bonds between Cys7 and Cys28/Cys13 and Cys33/Cys17 and Cys35) | 100ug | $283 | 2021-12-16 | Buy |
Properties
RTECS :FL7535000
storage temp. :-20°C
form :lyophilized powder
Water Solubility :Soluble to 1 mg/ml in water
Sequence :{Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
InChIKey :CNVQLPPZGABUCM-LIGYZCPXSA-N
storage temp. :-20°C
form :lyophilized powder
Water Solubility :Soluble to 1 mg/ml in water
Sequence :{Glp}-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
InChIKey :CNVQLPPZGABUCM-LIGYZCPXSA-N
Safety Information
| Symbol(GHS): |
|
||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal word: | Warning | ||||||||||||||||||||||||||||
| Hazard statements: |
|
||||||||||||||||||||||||||||
| Precautionary statements: |
|
Description
Charybdotoxin is a peptide found in the venom of the scorpion Leiurus quinquestriatus. MaxiK (High, BK) or IK1 (intermediate) conductance calcium-activated and Kv1.3 (voltage-gated channel) inhibitor. A potent and selective blocker of the large conductance Ca2+-activated K+, Slo channels in nanomolar concentrations as well as Kv1.2 (Kd = 14 nM) and Kv1.3 (Kd = 2.6 nM) channels. Present in GH3 anterior pituitary cells and primary bovine aortic smooth muscle cells.Related product price
-
Ethyl isocyanoacetate
$12.7-1687 -
METHYL ISOCYANOACETATE
$19-1275 -
14096-51-6
$40-1298
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Dideu Industries Group Limited
BOC Sciences
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.
Nanjing TGpeptide
Changsha MOL Changes Biotechnology Co., Ltd.




