CRF (OVINE)
|
|
- $217 - $1733.92
- Product name: CRF (OVINE)
- CAS: 9015-71-8
- MF: C205H339N59O63S1
- MW: 4670.31
- EINECS:
- MDL Number:MFCD00286536
- Synonyms:SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2;SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2;SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE;corticotropin-releasinghormone ;corticotropin-releasinghormone))- ;CORTICOTROPIN RELEASING FACTOR SHEEP;CORTICOTROPIN RELEASING FACTOR, OVINE;CRF (OVINE)
32 prices
Selected condition:
Brand
- Biorbyt Ltd
- Biosynth
- ChemScene
- Sigma-Aldrich
- Thermo Scientific Chemicals
- Usbiological
Package
- 10ug
- 50ug
- 0.1mg
- 100ug
- 250μg
- 0.5mg
- 1mg
- 5mg
- 10mg
- 50ul
- 100ul
- 200ul
- 96Tests
- ManufacturerBiorbyt Ltd
- Product numberorb611696
- Product descriptionCorticotropin-releasing factor (ovine)
- Packaging1mg
- Price$402.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611696
- Product descriptionCorticotropin-releasing factor (ovine)
- Packaging5mg
- Price$793.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611696
- Product descriptionCorticotropin-releasing factor (ovine)
- Packaging10mg
- Price$1326
- Updated2021-12-16
- Buy
- ManufacturerBiosynth
- Product numberPCR-4111-V
- Product descriptionCRF (Ovine)
- Packaging0.5mg
- Price$1733.92
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberPCR-4111-S
- Product descriptionCRF (Ovine)
- Packaging0.1mg
- Price$515.15
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0615545
- Product descriptionCorticotropin-releasing factor Sheep 99.67%
- Packaging10mg
- Price$812
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0615545
- Product descriptionCorticotropin-releasing factor Sheep 99.67%
- Packaging5mg
- Price$542
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0615545
- Product descriptionCorticotropin-releasing factor Sheep 99.67%
- Packaging1mg
- Price$217
- Updated2026-06-04
- Buy
- ManufacturerSigma-Aldrich
- Product numberC3167
- Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
- Packaging250μg
- Price$558
- Updated2026-04-30
- Buy
- ManufacturerSigma-Aldrich
- Product numberC3167
- Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
- Packaging0.5mg
- Price$975
- Updated2026-04-30
- Buy
- ManufacturerSigma-Aldrich
- Product numberC3167
- Product descriptionCorticotropin Releasing Factor sheep ≥95% (HPLC)
- Packaging1mg
- Price$1710
- Updated2026-04-30
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66708
- Product descriptionCorticotropin Releasing Factor, ovine
- Packaging1mg
- Price$357
- Updated2021-12-16
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66708
- Product descriptionCorticotropin Releasing Factor, ovine
- Packaging0.5mg
- Price$242.65
- Updated2026-04-24
- Buy
- ManufacturerUsbiological
- Product number154202
- Product descriptionCorticotropin Releasing Hormone
- Packaging10ug
- Price$333
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number154199
- Product descriptionCorticotropin Releasing Hormone
- Packaging10ug
- Price$333
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number154200
- Product descriptionCorticotropin Releasing Hormone
- Packaging10ug
- Price$333
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Biorbyt Ltd | orb611696 | Corticotropin-releasing factor (ovine) | 1mg | $402.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb611696 | Corticotropin-releasing factor (ovine) | 5mg | $793.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb611696 | Corticotropin-releasing factor (ovine) | 10mg | $1326 | 2021-12-16 | Buy |
| Biosynth | PCR-4111-V | CRF (Ovine) | 0.5mg | $1733.92 | 2026-06-04 | Buy |
| Biosynth | PCR-4111-S | CRF (Ovine) | 0.1mg | $515.15 | 2026-06-04 | Buy |
| ChemScene | CS-0615545 | Corticotropin-releasing factor Sheep 99.67% | 10mg | $812 | 2026-06-04 | Buy |
| ChemScene | CS-0615545 | Corticotropin-releasing factor Sheep 99.67% | 5mg | $542 | 2026-06-04 | Buy |
| ChemScene | CS-0615545 | Corticotropin-releasing factor Sheep 99.67% | 1mg | $217 | 2026-06-04 | Buy |
| Sigma-Aldrich | C3167 | Corticotropin Releasing Factor sheep ≥95% (HPLC) | 250μg | $558 | 2026-04-30 | Buy |
| Sigma-Aldrich | C3167 | Corticotropin Releasing Factor sheep ≥95% (HPLC) | 0.5mg | $975 | 2026-04-30 | Buy |
| Sigma-Aldrich | C3167 | Corticotropin Releasing Factor sheep ≥95% (HPLC) | 1mg | $1710 | 2026-04-30 | Buy |
| Thermo Scientific Chemicals | J66708 | Corticotropin Releasing Factor, ovine | 1mg | $357 | 2021-12-16 | Buy |
| Thermo Scientific Chemicals | J66708 | Corticotropin Releasing Factor, ovine | 0.5mg | $242.65 | 2026-04-24 | Buy |
| Usbiological | 154202 | Corticotropin Releasing Hormone | 10ug | $333 | 2021-12-16 | Buy |
| Usbiological | 154199 | Corticotropin Releasing Hormone | 10ug | $333 | 2021-12-16 | Buy |
| Usbiological | 154200 | Corticotropin Releasing Hormone | 10ug | $333 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :Solid
form :Solid
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
CRH is a key activator of the hypothalamo-pituitaryadrenal (HPA) axis in response to internal or external stresses by stimulating adrenocorticotropic hormone (ACTH) secretion from the pituitary.Related product price
-
Superoxide dismutase
$61.9-3720 -
HEMOGLOBIN
$27-1720 -
Melatonine
$6-10912.6
Suppliers and manufacturers
GL Biochem (Shanghai) Ltd
Chengdu HuaXia Chemical Reagent Co. Ltd
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Sigma-Aldrich
Shanghai Xilong Biochemical Technology Co., Ltd.
Nanjing Peptide Biotech Ltd.
Hangzhou Peptidego Biotech Co.,Ltd.
BOC Sciences
Hangzhou Go Top Peptide Biotech
AFINE CHEMICALS LIMITED




