Calcitonin
|
- $531 - $2563.6
- Product name: Calcitonin
- CAS: 9007-12-9
- MF: C145H240N44O48S2
- MW: 3431.85
- EINECS:232-693-2
- MDL Number:MFCD00133860
- Synonyms:calcimar(salmon) ;calcitar ;calcitrin ;SALMON;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7)
19 prices
Selected condition:
Brand
- Biorbyt Ltd
- Usbiological
Package
- 1mg
- 5mg
- 10mg
- 100ul
- 96Tests
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging1mg
- Price$691.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging5mg
- Price$1713.6
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb364460
- Product descriptionCalcitonin > 95%
- Packaging10mg
- Price$2563.6
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-29
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-24
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-27
- Product descriptionCalcitonin
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-23
- Product descriptionCalcitonin
- Packaging5mg
- Price$691
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-26
- Product descriptionCalcitonin
- Packaging5mg
- Price$691
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-28
- Product descriptionCalcitonin
- Packaging1mg
- Price$701
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-16A-Biotin
- Product descriptionCalcitonin
- Packaging100ul
- Price$1020
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-16A-FITC
- Product descriptionCalcitonin
- Packaging100ul
- Price$1020
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-16A-AP
- Product descriptionCalcitonin
- Packaging100ul
- Price$1020
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-16A-PE
- Product descriptionCalcitonin
- Packaging100ul
- Price$1020
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-25
- Product descriptionCalcitonin
- Packaging1mg
- Price$701
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-30
- Product descriptionCalcitonin
- Packaging1mg
- Price$701
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberC0115-22
- Product descriptionCalcitonin
- Packaging1mg
- Price$779
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 1mg | $691.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 5mg | $1713.6 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb364460 | Calcitonin > 95% | 10mg | $2563.6 | 2021-12-16 | Buy |
| Usbiological | C0115-29 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | C0115-24 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | C0115-27 | Calcitonin | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | C0115-23 | Calcitonin | 5mg | $691 | 2021-12-16 | Buy |
| Usbiological | C0115-26 | Calcitonin | 5mg | $691 | 2021-12-16 | Buy |
| Usbiological | C0115-28 | Calcitonin | 1mg | $701 | 2021-12-16 | Buy |
| Usbiological | C0115-16A-Biotin | Calcitonin | 100ul | $1020 | 2021-12-16 | Buy |
| Usbiological | C0115-16A-FITC | Calcitonin | 100ul | $1020 | 2021-12-16 | Buy |
| Usbiological | C0115-16A-AP | Calcitonin | 100ul | $1020 | 2021-12-16 | Buy |
| Usbiological | C0115-16A-PE | Calcitonin | 100ul | $1020 | 2021-12-16 | Buy |
| Usbiological | C0115-25 | Calcitonin | 1mg | $701 | 2021-12-16 | Buy |
| Usbiological | C0115-30 | Calcitonin | 1mg | $701 | 2021-12-16 | Buy |
| Usbiological | C0115-22 | Calcitonin | 1mg | $779 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder
solubility :0.05 M acetic acid: 1 mg/mL, clear, colorless
form :powder
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Calcitonin has been approved for the treatment of postmenopausal osteoporosis, hypercalcemia of malignancy, and Paget's disease of the bone.Several sources are available (e.g., eel, human, salmon, and porcine). The calcitonin isolated from salmon is the preferred source, because it has greater receptor affinity and a longer half-life than the human hormone.More related product prices
Calcitonin salmonRelated product price
- Elcatonin
$159-782.23 - Calcitonin salmon
$120-4090 - CALCITONIN, RAT
$55-1347.8




