Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> EXENDIN-3

EXENDIN-3

EXENDIN-3 price.
  • $292 - $1700
  • Product name: EXENDIN-3
  • CAS: 130357-25-4
  • MF: C184H282N50O61S
  • MW: 4202.57128
  • EINECS:
  • MDL Number:MFCD00240170
  • Synonyms:HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-3;HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;M.W. 4202.57 C184H282N50O61S;HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;Exendin-3 >=97%;EXENDIN-3 USP/EP/BP
18 prices
Selected condition:
Brand
  • aablocks
  • Arctom
  • Biorbyt Ltd
  • Biosynth
  • ChemScene
  • Thermo Scientific Chemicals
  • Usbiological
Package
  • 100ug
  • 250ug
  • 500ug
  • 1000ug
  • 1mg
  • 2000ug
  • 5mg
  • 10mg
  • Manufactureraablocks
  • Product numberAA01EAP7
  • Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
  • Packaging5mg
  • Price$419
  • Updated2026-05-30
  • Buy
  • Manufactureraablocks
  • Product numberAA01EAP7
  • Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
  • Packaging10mg
  • Price$647
  • Updated2026-05-30
  • Buy
  • ManufacturerArctom
  • Product numberHY-P1543
  • Product descriptionExendin-3 98.31%
  • Packaging5mg
  • Price$328
  • Updated2026-05-26
  • Buy
  • ManufacturerArctom
  • Product numberHY-P1543
  • Product descriptionExendin-3 98.31%
  • Packaging10mg
  • Price$523
  • Updated2026-05-26
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb2694980
  • Product descriptionExendin 3 ≥95%
  • Packaging5mg
  • Price$490
  • Updated2026-05-06
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb2694980
  • Product descriptionExendin 3 ≥95%
  • Packaging10mg
  • Price$800
  • Updated2026-05-06
  • Buy
  • ManufacturerBiosynth
  • Product numberFE110340
  • Product descriptionExendin-3
  • Packaging100ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFE110340
  • Product descriptionExendin-3
  • Packaging250ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFE110340
  • Product descriptionExendin-3
  • Packaging500ug
  • Price$900
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFE110340
  • Product descriptionExendin-3
  • Packaging1000ug
  • Price$980
  • Updated2026-06-04
  • Buy
  • ManufacturerBiosynth
  • Product numberFE110340
  • Product descriptionExendin-3
  • Packaging2000ug
  • Price$1700
  • Updated2026-06-04
  • Buy
  • ManufacturerChemScene
  • Product numberCS-0045118
  • Product descriptionExendin-3 98.31%
  • Packaging5mg
  • Price$374
  • Updated2026-06-04
  • Buy
  • ManufacturerChemScene
  • Product numberCS-0045118
  • Product descriptionExendin-3 98.31%
  • Packaging5mg
  • Price$374
  • Updated2026-06-04
  • Buy
  • ManufacturerChemScene
  • Product numberCS-0045118
  • Product descriptionExendin-3 98.31%
  • Packaging10mg
  • Price$596
  • Updated2026-06-04
  • Buy
  • ManufacturerChemScene
  • Product numberCS-0045118
  • Product descriptionExendin-3 98.31%
  • Packaging10mg
  • Price$596
  • Updated2026-06-04
  • Buy
  • ManufacturerThermo Scientific Chemicals
  • Product numberJ66793
  • Product descriptionExendin 3
  • Packaging1mg
  • Price$292
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
aablocks AA01EAP7 Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% 5mg $419 2026-05-30 Buy
aablocks AA01EAP7 Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% 10mg $647 2026-05-30 Buy
Arctom HY-P1543 Exendin-3 98.31% 5mg $328 2026-05-26 Buy
Arctom HY-P1543 Exendin-3 98.31% 10mg $523 2026-05-26 Buy
Biorbyt Ltd orb2694980 Exendin 3 ≥95% 5mg $490 2026-05-06 Buy
Biorbyt Ltd orb2694980 Exendin 3 ≥95% 10mg $800 2026-05-06 Buy
Biosynth FE110340 Exendin-3 100ug $900 2026-06-04 Buy
Biosynth FE110340 Exendin-3 250ug $900 2026-06-04 Buy
Biosynth FE110340 Exendin-3 500ug $900 2026-06-04 Buy
Biosynth FE110340 Exendin-3 1000ug $980 2026-06-04 Buy
Biosynth FE110340 Exendin-3 2000ug $1700 2026-06-04 Buy
ChemScene CS-0045118 Exendin-3 98.31% 5mg $374 2026-06-04 Buy
ChemScene CS-0045118 Exendin-3 98.31% 5mg $374 2026-06-04 Buy
ChemScene CS-0045118 Exendin-3 98.31% 10mg $596 2026-06-04 Buy
ChemScene CS-0045118 Exendin-3 98.31% 10mg $596 2026-06-04 Buy
Thermo Scientific Chemicals J66793 Exendin 3 1mg $292 2021-12-16 Buy

Properties

storage temp. :−20°C
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :LMHMJYMCGJNXRS-IEQINRSDSA-N

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Exendin-3 has been used to assess its effect in glucagon receptor knockout mice (Gcgr-/-) and wild-type mice, on glucose-stimulated insulin secretion.

Related product price