EXENDIN-3
|
- $292 - $1700
- Product name: EXENDIN-3
- CAS: 130357-25-4
- MF: C184H282N50O61S
- MW: 4202.57128
- EINECS:
- MDL Number:MFCD00240170
- Synonyms:HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-3;HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;M.W. 4202.57 C184H282N50O61S;HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;Exendin-3 >=97%;EXENDIN-3 USP/EP/BP
16 prices
Selected condition:
Brand
- aablocks
- Arctom
- Biorbyt Ltd
- Biosynth
- ChemScene
- Thermo Scientific Chemicals
- Usbiological
Package
- 100ug
- 250ug
- 500ug
- 1000ug
- 1mg
- 2000ug
- 5mg
- 10mg
- Manufactureraablocks
- Product numberAA01EAP7
- Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
- Packaging5mg
- Price$419
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAP7
- Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
- Packaging10mg
- Price$647
- Updated2026-05-30
- Buy
- ManufacturerArctom
- Product numberHY-P1543
- Product descriptionExendin-3 98.31%
- Packaging10mg
- Price$523
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1543
- Product descriptionExendin-3 98.31%
- Packaging5mg
- Price$328
- Updated2026-05-26
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb2694980
- Product descriptionExendin 3 ≥95%
- Packaging5mg
- Price$490
- Updated2026-05-06
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb2694980
- Product descriptionExendin 3 ≥95%
- Packaging10mg
- Price$800
- Updated2026-05-06
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging100ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging500ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging1000ug
- Price$980
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging2000ug
- Price$1700
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging10mg
- Price$596
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging5mg
- Price$374
- Updated2026-06-04
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66793
- Product descriptionExendin 3
- Packaging1mg
- Price$292
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product numberE9050-01
- Product descriptionExendin 3
- Packaging1mg
- Price$531
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number255276
- Product descriptionExendin 3
- Packaging1mg
- Price$749
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAP7 | Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% | 5mg | $419 | 2026-05-30 | Buy |
| aablocks | AA01EAP7 | Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% | 10mg | $647 | 2026-05-30 | Buy |
| Arctom | HY-P1543 | Exendin-3 98.31% | 10mg | $523 | 2026-05-26 | Buy |
| Arctom | HY-P1543 | Exendin-3 98.31% | 5mg | $328 | 2026-05-26 | Buy |
| Biorbyt Ltd | orb2694980 | Exendin 3 ≥95% | 5mg | $490 | 2026-05-06 | Buy |
| Biorbyt Ltd | orb2694980 | Exendin 3 ≥95% | 10mg | $800 | 2026-05-06 | Buy |
| Biosynth | FE110340 | Exendin-3 | 100ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 250ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 500ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 1000ug | $980 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 2000ug | $1700 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 10mg | $596 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 5mg | $374 | 2026-06-04 | Buy |
| Thermo Scientific Chemicals | J66793 | Exendin 3 | 1mg | $292 | 2021-12-16 | Buy |
| Usbiological | E9050-01 | Exendin 3 | 1mg | $531 | 2021-12-16 | Buy |
| Usbiological | 255276 | Exendin 3 | 1mg | $749 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :LMHMJYMCGJNXRS-IEQINRSDSA-N
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :LMHMJYMCGJNXRS-IEQINRSDSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Exendin-3 has been used to assess its effect in glucagon receptor knockout mice (Gcgr-/-) and wild-type mice, on glucose-stimulated insulin secretion.Related product price
-
COBALT(II) ACETYLACETONATE
$43-1161 -
Cupric acetylacetonate
$6-4747 -
Aluminum acetylacetonate
$5-12900
Suppliers and manufacturers
Nanjing TGpeptide Biotechnology Co.,Ltd.
Shanghai HongTide Biotechnology Co.,Ltd.
GL Biochem (Shanghai) Ltd
Shanghai Hanhong Scientific Co.,Ltd.
Chemsky (shanghai) International Co.,Ltd
Cellmano Biotech Limited
Wuxi Zhongkun Biochemical Technology Co., Ltd.
Creative Peptides
Shanghai YuanYe Biotechnology Co., Ltd.
Nanjing Leon Biological Technology Co., Ltd.




