EXENDIN-3
|
- $292 - $1700
- Product name: EXENDIN-3
- CAS: 130357-25-4
- MF: C184H282N50O61S
- MW: 4202.57128
- EINECS:
- MDL Number:MFCD00240170
- Synonyms:HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;EXENDIN-3;HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;M.W. 4202.57 C184H282N50O61S;HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;Exendin-3 >=97%;EXENDIN-3 USP/EP/BP
18 prices
Selected condition:
Brand
- aablocks
- Arctom
- Biorbyt Ltd
- Biosynth
- ChemScene
- Thermo Scientific Chemicals
- Usbiological
Package
- 100ug
- 250ug
- 500ug
- 1000ug
- 1mg
- 2000ug
- 5mg
- 10mg
- Manufactureraablocks
- Product numberAA01EAP7
- Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
- Packaging5mg
- Price$419
- Updated2026-05-30
- Buy
- Manufactureraablocks
- Product numberAA01EAP7
- Product descriptionExendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98%
- Packaging10mg
- Price$647
- Updated2026-05-30
- Buy
- ManufacturerArctom
- Product numberHY-P1543
- Product descriptionExendin-3 98.31%
- Packaging5mg
- Price$328
- Updated2026-05-26
- Buy
- ManufacturerArctom
- Product numberHY-P1543
- Product descriptionExendin-3 98.31%
- Packaging10mg
- Price$523
- Updated2026-05-26
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb2694980
- Product descriptionExendin 3 ≥95%
- Packaging5mg
- Price$490
- Updated2026-05-06
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb2694980
- Product descriptionExendin 3 ≥95%
- Packaging10mg
- Price$800
- Updated2026-05-06
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging100ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging250ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging500ug
- Price$900
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging1000ug
- Price$980
- Updated2026-06-04
- Buy
- ManufacturerBiosynth
- Product numberFE110340
- Product descriptionExendin-3
- Packaging2000ug
- Price$1700
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging5mg
- Price$374
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging5mg
- Price$374
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging10mg
- Price$596
- Updated2026-06-04
- Buy
- ManufacturerChemScene
- Product numberCS-0045118
- Product descriptionExendin-3 98.31%
- Packaging10mg
- Price$596
- Updated2026-06-04
- Buy
- ManufacturerThermo Scientific Chemicals
- Product numberJ66793
- Product descriptionExendin 3
- Packaging1mg
- Price$292
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| aablocks | AA01EAP7 | Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% | 5mg | $419 | 2026-05-30 | Buy |
| aablocks | AA01EAP7 | Exendin-3 H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 >98% | 10mg | $647 | 2026-05-30 | Buy |
| Arctom | HY-P1543 | Exendin-3 98.31% | 5mg | $328 | 2026-05-26 | Buy |
| Arctom | HY-P1543 | Exendin-3 98.31% | 10mg | $523 | 2026-05-26 | Buy |
| Biorbyt Ltd | orb2694980 | Exendin 3 ≥95% | 5mg | $490 | 2026-05-06 | Buy |
| Biorbyt Ltd | orb2694980 | Exendin 3 ≥95% | 10mg | $800 | 2026-05-06 | Buy |
| Biosynth | FE110340 | Exendin-3 | 100ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 250ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 500ug | $900 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 1000ug | $980 | 2026-06-04 | Buy |
| Biosynth | FE110340 | Exendin-3 | 2000ug | $1700 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 5mg | $374 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 5mg | $374 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 10mg | $596 | 2026-06-04 | Buy |
| ChemScene | CS-0045118 | Exendin-3 98.31% | 10mg | $596 | 2026-06-04 | Buy |
| Thermo Scientific Chemicals | J66793 | Exendin 3 | 1mg | $292 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :LMHMJYMCGJNXRS-IEQINRSDSA-N
solubility :Soluble in DMSO
form :Solid
color :White to off-white
Sequence :His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
InChIKey :LMHMJYMCGJNXRS-IEQINRSDSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Exendin-3 has been used to assess its effect in glucagon receptor knockout mice (Gcgr-/-) and wild-type mice, on glucose-stimulated insulin secretion.Related product price
-
N-BUTYLISOCYANIDE
$45-1028.41 -
Ferric acetylacetonate
$5-2359.48 -
15522-71-1
$18-982.81
Suppliers and manufacturers
Hangzhou Huarong Pharm Co., Ltd.
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Career Henan Chemica Co
Dideu Industries Group Limited
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.
Nanjing TGpeptide
Changsha MOL Changes Biotechnology Co., Ltd.
Moxin Chemicals
Exendin-3
CAS:130357-25-4




