Welcome to chemicalbook!
010-86108875
RFQ
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> Parstatin (human)

Parstatin (human)

Parstatin (human) price.
  • $352 - $692
  • Product name: Parstatin (human)
  • CAS: 1065755-99-8
  • MF: C191H330N64O53S3
  • MW: 0
  • EINECS:
  • MDL Number:
  • Synonyms:Parstatin (human);MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR;Parstatin (human) TFA
3 prices
Selected condition:
Brand
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Tocris
Package
  • 1
  • 1mg
  • 5MG
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0004614
  • Product descriptionPARSTATIN-HUMAN 95.00%
  • Packaging5MG
  • Price$504.42
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5450
  • Product descriptionParstatin(human)
  • Packaging1mg
  • Price$692
  • Updated2021-12-16
  • Buy
  • ManufacturerTocris
  • Product number3553
  • Product descriptionParstatin(human)
  • Packaging1
  • Price$352
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
American Custom Chemicals Corporation PEP0004614 PARSTATIN-HUMAN 95.00% 5MG $504.42 2021-12-16 Buy
ApexBio Technology B5450 Parstatin(human) 1mg $692 2021-12-16 Buy
Tocris 3553 Parstatin(human) 1 $352 2021-12-16 Buy

Properties

storage temp. :Store at -20°C
form :Powder
Water Solubility :Soluble to 1 mg/ml in water

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50~ 3μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activityin vitro. Inhibits angiogenesis and exhibits cardioprotective activityin vivo.

More related product prices

Parstatin (mouse)

Related product price