83930-13-6 Basic information More..
Product Name:GRF (1-44) (HUMAN)
Synonyms:SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN (HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin;SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
CAS:83930-13-6
MF:C215H358N72O66S
MW:5039.65082
EINECS:
Mol File:83930-13-6.mol
83930-13-6

GRF (1-44) (HUMAN) manufacturers

Information Error Report
Your Email:
83930-13-6 Recommend Suppliers
Recommend You Select Member Companies...
Company Name: Cellmano Biotech Limited      Recommend     Complaint
Tel: 0551-65326643
FAX: 0551-65326641
Email: info@cellmano.com
Nationality: China
Products Intro: Product Name:GRF (human) Acetate
CAS:83930-13-6
Purity:98.0% min
CB Index: 58
WebSite: http://www.cellmano.com/
Related Information: Sales Network   Catalog(995)   User Evaluation
Company Name: Changzhou Xuanming Pharmaceutical Technology Co., Ltd.      Recommend     Complaint
Tel: +86-519-85525359
FAX:
Email: sales@xuanmingchem.com
Nationality: China
Products Intro: Product Name:GRF (human) Acetate
CAS:83930-13-6
Purity:98%,99% HPLC Package:Grams
CB Index: 58
WebSite: https://www.xuanmingchem.com
Related Information: Sales Network   Catalog(912)   User Evaluation
Company Name: Hubei xin bonus chemical co. LTD      Recommend     Complaint
Tel: 86-13657291602
FAX: 027-59338440
Email: linda@hubeijusheng.com
Nationality: CHINA
Products Intro: Product Name:GRF (1-44) (HUMAN)
CAS:83930-13-6
Purity:0.99 Package:5KG;1KG
CB Index: 58
WebSite: www.chemicalbook.com/ShowSupplierProductsList1549548/0_EN.htm
Related Information: Sales Network   Catalog(22963)   User Evaluation
Company Name: SIMAGCHEM CORP      Recommend     Complaint
Tel: +86-5922680277
FAX:
Email: sale@simagchem.com
Nationality: China
Products Intro: Product Name:Grf (Human) Acetate
CAS:83930-13-6
Purity:0.99 Package:1kg,5kg,25kgs,200kgs;bulk
CB Index: 58
WebSite: http://www.simagchem.com/
Related Information: Sales Network   Catalog(17346)   User Evaluation
Company Name: Dideu Industries Group Limited      Recommend     Complaint
Tel: +86-29-89586680
FAX:
Email: 1026@dideu.com
Nationality: China
Products Intro: Product Name:GRF (1-44) (HUMAN)
CAS:83930-13-6
Purity:99.9% Package:25kgs/Drum;200kgs/Drum Remarks:FDA GMP CEP Approved Manufacturer
CB Index: 58
WebSite: https://www.dideu.com
Related Information: Sales Network   Catalog(20284)   User Evaluation
Company Name: Baoji Guokang Healthchem Co., Ltd.      Recommend     Complaint
Tel: +86-0917-3909592
FAX: 09173909592
Email: gksales1@gk-bio.com
Nationality: China
Products Intro: Product Name:GRF (human)
CAS:83930-13-6
Package:1mg;10mg;100mg;1G
CB Index: 58
WebSite: www.gk-chemical.com/
Related Information: Sales Network   Catalog(9230)   User Evaluation
Company Name: Zhejiang J&C Biological Technology Co.,Limited      Recommend     Complaint
Tel: +1-2135480471
FAX:
Email: sales@sarms4muscle.com
Nationality: China
Products Intro: Product Name:Somatorelin GRF(human)Acetate
CAS:83930-13-6
Purity:99% Package:5KG;1KG
CB Index: 58
WebSite: https://www.sarms4muscle.com
Related Information: Sales Network   Catalog(10473)   User Evaluation
Company Name: Hangzhou Go Top Peptide Biotech      Recommend     Complaint
Tel: 0571-88211921
FAX:
Email: sales1@gotopbio.com
Nationality: CHINA
Products Intro: Product Name:GHRF(1-44),human
CAS:83930-13-6
Purity:98% HPLC、MS Package:1mg/ plastic bottle ,customer's requirement packaging also welcome
CB Index: 58
WebSite: http://www.gotopbio.com/
Related Information: Sales Network   Catalog(2609)   User Evaluation
1 2 3 4 5 6 7 8 9 10 11 12
Tag: 83930-13-6
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.