(D-Ala2)-Gastric Inhibitory Polypeptide (human)

444073-04-5 Basic information More..

Product Name:	(D-Ala2)-Gastric Inhibitory Polypeptide (human)
Synonyms:	(D-Ala2)-Gastric Inhibitory Polypeptide (human);[D-Ala2]-GIP (human);(D-Ala?)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt;Y（D-A）EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ;(D-Ala2)-Gastric Inhibitory Polypeptide (human) TFA
CAS:	444073-04-5
MF:	C22H27NO11
MW:	481.44988
EINECS:
Mol File:	444073-04-5.mol

Information Error Report

Your Email:

Browse by province 444073-04-5 Suppliers

444073-04-5 Recommend Suppliers

Recommend You Select Member Companies...

Company Name:	Shenzhen Nexconn Pharmatechs Ltd Recommend Complaint

Tel:	+86-755-89396905
FAX:
Email:	admin@nexconn.com
Nationality:	China
Products Intro:	Product Name:D-Ala2]-GIP (human) CAS:444073-04-5 Purity:98% Package:1KG;10KG;50KG
CB Index:	58
WebSite:	https://www.chemicalbook.com/ShowSupplierProductsList31188/0.htm
Related Information:	Sales Network Catalog(10406) User Evaluation

Company Name:	Career Henan Chemica Co Recommend Complaint

Tel:	+86-0371-86658258
FAX:	0371-86658258
Email:	laboratory@coreychem.com
Nationality:	China
Products Intro:	Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human) CAS:444073-04-5 Purity:99% Package:1KG;7USD
CB Index:	58
WebSite:	www.coreychem.com/
Related Information:	Sales Network Catalog(30230) User Evaluation

Company Name:	Nanjing TGpeptide Recommend Complaint

Tel:	+86-13347807150
FAX:
Email:	support@tgpeptide.com
Nationality:	China
Products Intro:	Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human) CAS:444073-04-5 Purity:0.95 Package:1mg;5mg;10mg;50mg;100mg,1g
CB Index:	58
WebSite:	tgpeptides.com/index.aspx
Related Information:	Sales Network Catalog(3279) User Evaluation

Company Name:	Changsha MOL Changes Biotechnology Co., Ltd. Recommend Complaint

Tel:
FAX:
Email:	info@molchanges.com
Nationality:	China
Products Intro:	Product Name:D-Ala2]-GIP (human) CAS:444073-04-5 Purity:99% Package:5mg;10mg;100mg;1g;10g;100g
CB Index:	58
WebSite:	www.molchanges.com
Related Information:	Sales Network Catalog(5221) User Evaluation

Company Name:	Chengdu Youngshe Chemical Co., Ltd. Recommend Complaint

Tel:	+86-17380623303
FAX:	028-62328193
Email:	Caroline@youngshechem.com
Products Intro:	Product Name:D-Ala2]-GIP (human) CAS:444073-04-5 Purity:95% Package:1G; 10G; 100G More...
CB Index:	58
WebSite:	https://shop326109856.taobao.com/
Related Information:	Sales Network Catalog(4804) User Evaluation

Company Name:	Hangzhou Peptidego Biotech Co.,Ltd. Recommend Complaint

Tel:	0571-87213919
FAX:	0571-87213919
Email:	Eric@peptidego.com
Products Intro:	Product Name:[D-Ala2]-GIP (human) CAS:444073-04-5 Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement. More...
CB Index:	58
WebSite:	http://www.peptidego.com
Related Information:	Sales Network Catalog(7061) User Evaluation

Company Name:	Nanchang Tianzhen Biotechnology Co., Ltd Recommend Complaint

Tel:
FAX:
Email:	pomy@tanzhenbio.com
Products Intro:	Product Name:D-Ala2]-GIP (human) CAS:444073-04-5 Purity:>95% HPLC Package:10mg,100mg,1g More...
CB Index:	58
WebSite:	http://www.tanzhenbio.com
Related Information:	Sales Network Catalog(1903) User Evaluation

Company Name:	Nanjing TGpeptide Biotechnology Co.,Ltd. Recommend Complaint

Tel:
FAX:
Email:	sales@tgpeptide.com
Products Intro:	Product Name:(D-Ala2)-Gastric Inhibitory Polypeptide (human) CAS:444073-04-5 Purity:95% HPLC Package:5mg;25mg;100mg;1g More...
CB Index:	58
WebSite:	http://www.tgpeptide.com/Index.aspx
Related Information:	Sales Network Catalog(3058) User Evaluation

1 2 3

Tag: 444073-04-5

HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

Login