Endorphin, porcine, - Basic information More..
Product Name:Endorphin, porcine, -
Synonyms:Endorphin, porcine, -;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-VAL-LYS-ASN-ALA-HIS-LYS-LYS-GLY-GLN
CAS:
MF:
MW:0
EINECS:
Mol File:Mol File
Endorphin, porcine, -
Information Error Report
Your Email:
Browse by province Endorphin, porcine, - Suppliers Global suppliers
Shanghai(1) Jiangsu(2) Member(3) All(3)
Endorphin, porcine, - Recommend Suppliers
Recommend You Select Member Companies...
Company Name: GL Biochem (Shanghai) Ltd      Recommend    Complaint
Tel: 21-61263452
FAX: 86-21-61263399
Email: ymbetter@glbiochem.com
Products Intro: Product Name:β-Endorphin, porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g   More...
CB Index: 64
WebSite: http://www.glschina.com/
Related Information: Sales Network   Catalog(9981)   User Evaluation(7)
Company Name: Nanjing Peptide Biotech Ltd.      Recommend    Complaint
Tel: 025-025-58361106-805-805
FAX: 025-58361106-806
Email: liugang@njpeptide.com
Products Intro: Product Name:β-Endorphin, porcine;YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC   More...
CB Index: 55
WebSite: http://www.njpeptide.com
Related Information: Sales Network   Catalog(9980)   User Evaluation
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.      Recommend    Complaint
Tel: meitaochem@126.com
FAX:
Email: meitaochem@126.com
Products Intro: Product Name:β-Endorphin, porcine; YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ
Purity:99% HPLC Package:500g;1kg;5kg;25kg   More...
CB Index: 58
WebSite: www.chemicalbook.com/ShowSupplierProductsList31244/0.htm
Related Information: Sales Network   Catalog(19103)   User Evaluation
1
Tag: Endorphin, porcine, -
  • HomePage | About Us | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.