| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
| Company Name: |
Nanjing Peptide Biotech Ltd.
|
| Tel: |
025-025-58361106-805-805 13082558573 |
| Email: |
liugang@njpeptide.com |
| Products Intro: |
Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
|
| | b-Endorphin: 1-27, camel, bovine, ovine Basic information |
| Product Name: | b-Endorphin: 1-27, camel, bovine, ovine | | Synonyms: | b-Endorphin: 1-27, camel, bovine, ovine;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-HIS-LYS-LYS-GLY-GLN: YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![b-Endorphin: 1-27, camel, bovine, ovine Structure]() |
| | b-Endorphin: 1-27, camel, bovine, ovine Chemical Properties |
| | b-Endorphin: 1-27, camel, bovine, ovine Usage And Synthesis |
| | b-Endorphin: 1-27, camel, bovine, ovine Preparation Products And Raw materials |
|