b-Endorphin: 1-27, camel, bovine, ovine

b-Endorphin: 1-27, camel, bovine, ovine Suppliers list
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
Company Name: Nanjing Peptide Biotech Ltd.  
Tel: 025-025-58361106-805-805 13082558573
Email: liugang@njpeptide.com
Products Intro: Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Purity:99% HPLC Package:500g;1kg;5kg;25kg
b-Endorphin: 1-27, camel, bovine, ovine Basic information
Product Name:b-Endorphin: 1-27, camel, bovine, ovine
Synonyms:b-Endorphin: 1-27, camel, bovine, ovine;TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-HIS-LYS-LYS-GLY-GLN: YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
CAS:
MF:
MW:0
EINECS:
Product Categories:
Mol File:Mol File
b-Endorphin: 1-27, camel, bovine, ovine Structure
b-Endorphin: 1-27, camel, bovine, ovine Chemical Properties
Safety Information
MSDS Information
b-Endorphin: 1-27, camel, bovine, ovine Usage And Synthesis
b-Endorphin: 1-27, camel, bovine, ovine Preparation Products And Raw materials
Tag:b-Endorphin: 1-27, camel, bovine, ovine Related Product Information

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.