Log in | Join Free | china | japan | germany

Growth Hormone Releasing Factor, GRF (1-44), amide, bovine

Request For Quotation
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Suppliers list
Company Name: Hangzhou Go Top Peptide Biotech
Tel: 0571-88211921
Email: sales1@gotopbio.com
Products Intro: Product Name:GrowthHormoneReleasingFactor,GRF(1-44),amide,bovine
Purity:98% HPLC、MS Package:1mg/ plastic bottle ,customer's requirement packaging also welcome
Company Name: GL Biochem (Shanghai) Ltd  
Tel: 21-61263452 13641803416
Email: ymbetter@glbiochem.com
Products Intro: Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine;YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Purity:95% HPLC 98% HPLC Package:1mg,5mg,10mg,25mg,100mg,1g,10g
Company Name: Wuxi Zhongkun Biochemical Technology Co., Ltd.  
Tel: 0510-85629785 18013409632
Email: sales@reading-chemicals.com
Products Intro: Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Purity:95%+ Package:根据客户需求包装
Company Name: Hangzhou Peptidego Biotech Co.,Ltd.  
Tel: 0571-87213919
Email: eric@peptidego.com
Products Intro: Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Purity:95% or 98% Package:1mg；5mg；10mg；50mg；100mg,1g or according to customer's detail requirement.
Company Name: Nanjing Meihao Pharmaceutical Technology Co., Ltd.  
Tel: meitaochem@126.com
Email: meitaochem@126.com
Products Intro: Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine; YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Purity:99% HPLC Package:500g;1kg;5kg;25kg
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Basic information
Product Name:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
Synonyms:Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2;Growth Hormone Releasing Factor, GRF (1-44), amide, bovine
CAS:
MF:
MW:0
EINECS:
Product Categories:peptide
Mol File:Mol File
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Structure
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Chemical Properties
Safety Information
MSDS Information
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Usage And Synthesis
Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Preparation Products And Raw materials
Tag:Growth Hormone Releasing Factor, GRF (1-44), amide, bovine Related Product Information