b-Endorphin: 1-27, human

b-Endorphin: 1-27, human Suppliers list

Company Name:	GL Biochem (Shanghai) Ltd
Tel:	21-61263452 13641803416
Email:	ymbetter@glbiochem.com
Products Intro:	Product Name:b-Endorphin: 1-27, human Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g

Company Name:	Nanjing Peptide Biotech Ltd.
Tel:	025-025-025-58361106-805-805-805 15951641583
Email:	zhao.xu@njpeptide.com
Products Intro:	Product Name:b-Endorphin: 1-27, human Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC

Company Name:	Nanjing Meihao Pharmaceutical Technology Co., Ltd.
Tel:	meitaochem@126.com
Email:	meitaochem@126.com
Products Intro:	Product Name:b-Endorphin: 1-27, human Purity:99% HPLC Package:500g;1kg;5kg;25kg

b-Endorphin: 1-27, human Basic information

Product Name:	b-Endorphin: 1-27, human
Synonyms:	TYR-GLY-GLY-PHE-MET-THR-SER-GLU-LYS-SER-GLN-THR-PRO-LEU-VAL-THR-LEU-PHE-LYS-ASN-ALA-ILE-ILE-LYS-ASN-ALA-TYR-LYS-LYS-GLY-GLU: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE;b-Endorphin: 1-27, human
CAS:
MF:
MW:	0
EINECS:
Product Categories:
Mol File:	Mol File

b-Endorphin: 1-27, human Chemical Properties

Safety Information

MSDS Information

b-Endorphin: 1-27, human Usage And Synthesis

b-Endorphin: 1-27, human Preparation Products And Raw materials

Tag:b-Endorphin: 1-27, human Related Product Information

HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

Login