| Company Name: |
GL Biochem (Shanghai) Ltd
|
| Tel: |
21-61263452 13641803416 |
| Email: |
ymbetter@glbiochem.com |
| Products Intro: |
Product Name:[Des Asp10]Decorsin
Purity:95% HPLC,98% HPLC Package:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g
|
| Company Name: |
Nanjing Peptide Biotech Ltd.
|
| Tel: |
025-58361106-805 15951641583 |
| Email: |
zhao.xu@njpeptide.com |
| Products Intro: |
Product Name:[Des Asp10]Decorsin
Purity:5mg,20mg,100mg,250mg,500mg,1g Package:90%HPLC,95%HPLC,98%HPLC
|
|
| | [Des Asp10]Decorsin Basic information |
| Product Name: | [Des Asp10]Decorsin | | Synonyms: | [Des Asp10]Decorsin;ALA-PRO-ARG-LEU-PRO-GLN-CYS-GLN-GLY-ASP-GLN-GLU-LYS-CYS-LEU-CYS-ASN-LYS-ASP-GLU-CYS-PRO-PRO-GLY-GLN-CYS-ARG-PHE-PRO-ARG-GLY-ASP-ALA-ASP-PRO-TYR-CYS-GLU: APRLPQCQGDQEKCLCNKDECPPGQCRFPRGDADPYCEDISULFIDE BRIDGE CYS7-CYS15, CYS17-CYS27, AND CYS22-38 | | CAS: | | | MF: | | | MW: | 0 | | EINECS: | | | Product Categories: | | | Mol File: | Mol File | ![[Des Asp10]Decorsin Structure]() |
| | [Des Asp10]Decorsin Chemical Properties |
| | [Des Asp10]Decorsin Usage And Synthesis |
| | [Des Asp10]Decorsin Preparation Products And Raw materials |
|