ChemicalBook > Product Catalog >Biochemical Engineering >Polypeptide >Exendin-4

Exendin-4

Exendin-4 Suppliers list
Company Name: SUZHOU TIANMA PHARMA GROUP TIANJI BIO-PHARMACEUTICAL CO., LTD.
Tel: 18315825527
Email: kevin@tianmapharma.com
Products Intro: Product Name:Exenatide;exendin-4
CAS:141758-74-9
Purity:99% Package:1g/bottle; 5g/bottle;10g/bottle;64g/bottle Remarks:Pharmaceutical
Company Name: Alpha Biopharmaceuticals Co., Ltd
Tel: 0086-411-39042497
Email: sales@alphabiopharm.com
Products Intro: Product Name:Exenatide Acetate
CAS:141758-74-9
Purity:99% Package:25mg; 50mg;250mg;Bulk
Company Name: Henan DaKen Chemical CO.,LTD.
Tel: +86-371-55531817
Email: info@dakenchem.com
Products Intro: Product Name:Exendin-4
CAS:141758-74-9
Purity:99% Package:100g,500g,1kg,5kg,10kg
Company Name: Henan Tianfu Chemical Co.,Ltd.
Tel: 0371-55170693
Email: info@tianfuchem.com
Products Intro: CAS:141758-74-9
Purity:99% Package:500G;1KG;5KG;25KG
Company Name: career henan chemical co
Tel: +86-371-86658258
Email: sales@coreychem.com
Products Intro: Product Name:Exendin-4
CAS:141758-74-9
Purity:99% Package:1KG;7USD

Lastest Price from Exendin-4 manufacturers

  • Exendin-4
  • US $7.00 / KG
  • 2019-07-06
  • CAS:141758-74-9
  • Min. Order: 1KG
  • Purity: 99%
  • Supply Ability: 100kg
Exendin-4 Basic information
New diabetes drugs Uses
Product Name:Exendin-4
Synonyms:EXENDIN-4;M.W. 4186.61 C184H282N50O60S;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4)
CAS:141758-74-9
MF:C184H282N50O60S
MW:4186.57188
EINECS:686-356-3
Product Categories:Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors
Mol File:141758-74-9.mol
Exendin-4 Structure
Exendin-4 Chemical Properties
RTECS VT9545000
storage temp. −20°C
form White to off-white solid.
Safety Information
WGK Germany 3
HS Code 2933290000
MSDS Information
ProviderLanguage
SigmaAldrich English
Exendin-4 Usage And Synthesis
New diabetes drugsDiabetes is a metabolic disorder characterized by chronic hyperglycemia caused by a variety of causes , high blood sugar is caused by insulin secretion or its effect defect. Diabetes can be divided into type 1 diabetes, type 2 diabetes, other specific types of diabetes, and gestational diabetes, among which type 2 diabetes account for more than 90%.
Exendin-4 is a new diabetes drug successfully developed by American Eli Lilly Company it belongs to incretin analogues, it is the first member of the incretin analogues family , it is the synthetic peptide compound, which can simulate physiological behavior of the natural state secretion of GLP-1 in vivo ,it is similar to human pancreatic glucagon-like peptide effect-1 (GLP-1),it can promote glucose-dependent insulin secretion, it has inhibition effect of inappropriate glucose-dependent glucagon secretion, slowing gastric emptying, it improves the sensitivity of peripheral tissues to insulin, and it makes blood sugar adequately controlled. Clinically it is used for the treatment of type Ⅱ diabetes patients whose blood sugar is unbale to be controlled by metformin, sulfonylurea, or combination of metformin and sulfonylurea.
From April 28, 2005 to October 29, 2008, the US Food and Drug Administration (abbreviation: FDA) Adverse Event Reporting System had received reports of 78 cases of patients with renal exenatide change. In the meantime, the United States had made a total of more than 6.6 million Exendin-4 prescription, therefore, FDA thought the received 78 cases was in a small proportion of the proportion of all patients reporting use of the drug. Currently FDA has completed an assessment of these reported cases, including 62 cases of acute renal failure cases and 16 cases of renal insufficiency cases. Acute renal failure or renal dysfunction occurs three days to two years after treatment. The age span is 23 years to 83 years, mean age is 60 years.
The above information is edited by the chemicalbook of Tian Ye.
UsesExendin-4 can activate the GLP-1 receptor, the receptor can increase cAMP levels of pancreatic acinar cells in intracellular , but it has no effect on VIP receptor.
DescriptionExenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.
OriginatorAmylin (US)
UsesAntidiabetic.
DefinitionChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.
Brand nameByetta
Exendin-4 Preparation Products And Raw materials
Tag:Exendin-4(141758-74-9) Related Product Information
Vildagliptin Albiglutide Liraglutide Lixisenatide Rosiglitazone Repaglinide Metformin TOLBUTAMIDE Goserelin Stanozolol Triptorelin Somatostatin Elcatonin BIOTIN-EXENDIN 4 EXENDIN (5-39) EXENDIN 4 (48-83) [HELODERMA SUSPECTUM] EXENDIN (9-39), [125I]- EXENDIN-3 (9-39) AMIDE,EXENDIN 3 (9-39),EXENDIN [9-39] PEPTIDE,EXENDIN (9-39),EXENDIN (9-39) AMIDE,EXENDIN FRAGMENT 9-39